KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a824Help
Entry
PSEBR_a824        CDS       T01472                                 

Definition
(GenBank) Amidase, (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase), subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00970  Aminoacyl-tRNA biosynthesis
pba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pba00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PSEBR_a824
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pba03029]
    PSEBR_a824
Enzymes [BR:pba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PSEBR_a824
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PSEBR_a824
Mitochondrial biogenesis [BR:pba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PSEBR_a824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AEA66990
UniProt: F2KCD7
Position
complement(1070264..1071709)
Genome map
AA seq 481 aa AA seqDB search
MQWEVVIGLEIHTQLTTRSKIFSGSSTTFGSEPNTQASLVDLGMPGVLPVLNAEAVRMAV
MFGLAIDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIALEDGTVKRVGIT
RAHLEEDAGKSLHEEFNGATGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHALVRYL
GICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIELIED
GGKVIQQTRLYDPNKDETRPMRSKEEANDYRYFPDPDLLPVVIENSFLDEVRATLPELPP
QKRERFQAQFGLSSYDANVLATSREQADYFEKVVSIGGDAKLAANWVMVELGSLLNKQGL
EIDQSPVSAEQLGGMLVRIKDNTISGKIAKMVFEAMANGEGSADEIIEKRGLKQVTDTGA
ISAVLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKSKLE
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgggaagtcgtgatcgggctggagattcatacccagctcaccacccggtcgaaa
atcttttccggtagctccaccacgttcggctccgagcccaacacccaggccagcctggtc
gacctgggcatgcccggcgttctgccggtgctcaacgccgaagcggtgcgcatggcggtg
atgttcggcctggcgattgacgccgagatcggccagcacaacgtgttcgcccgcaagaac
tacttctacccggacctgcccaagggctaccagatcagccagatggaattgccgatcgta
ggcaagggccacctggacatcgccctggaagacggcacggtcaaacgcgtcggcatcacc
cgggcgcacctggaagaagatgccggcaagagcctgcacgaagaattcaacggtgccacc
ggcatcgacctgaaccgcgccggcacgccgctgctggaaatcgtttccgagccggacatg
cgcagcgccaaggaagccgtggcctacgtcaaggcgatccacgcattggtgcgctacctg
ggcatctgcgacggcaacatggccgaaggttcgctgcgctgcgactgcaacgtatcgatc
cggcccaagggccaggtcgagttcggcacccgctgcgagatcaagaacgtcaactcgttc
cgcttcatcgagaaggcgatcaacagcgagatccagcgccagatcgaactgatcgaggac
ggtggcaaggtcatccagcagacccgcctgtacgacccgaacaaggacgagacccgtccg
atgcgcagcaaggaagaagccaacgactaccgttacttccccgacccggacctgctgccg
gtggttatcgagaactcgttcctcgacgaggtgcgcgccaccctgccggaactgccgccg
caaaaacgcgagcgcttccaggcgcaattcgggctgtcgagctatgacgccaacgtcctg
gccaccagtcgcgaacaggccgattacttcgagaaagtcgtgagcatcggcggcgacgcc
aagctggcggccaactgggtgatggtggaactgggcagcctgttgaacaaacagggactg
gaaatcgaccagtcgccggtctcggccgaacaactgggcggcatgctggtgcggatcaag
gacaacaccatttccggcaagatcgccaagatggtgttcgaagccatggccaatggtgaa
ggcagcgccgacgagatcatcgagaagcgcggcttgaagcaggtcaccgataccggcgcc
atttccgccgtgctcgatgaaatgctcgcggccaacgccgagcaggtcgaacagtaccgt
gcggcagacgaagccaagcgcggcaaaatgttcggcttcttcgtcggccaggccatgaaa
gcctccaagggcaaggccaacccgcaacaggtcaacgaactgctcaaaagcaagctcgag
ggctga

DBGET integrated database retrieval system