KEGG   Pogonomyrmex barbatus (red harvester ant): 105422302Help
Entry
105422302         CDS       T04903                                 

Definition
(RefSeq) septin-7 isoform X1
  KO
K16944  septin 7
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pbar04131]
    105422302
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pbar04812]
    105422302
   04147 Exosome [BR:pbar04147]
    105422302
Membrane trafficking [BR:pbar04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    105422302
Cytoskeleton proteins [BR:pbar04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     105422302
Exosome [BR:pbar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105422302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 Exonuc_VII_L ASD2 Gtr1_RagA FeoB_N AAA_16 ABC_tran Ras Gp-FAR-1 AAA_29 AAA_22 Roc Angiomotin_C Atg14 FapA LCD1
Motif
Other DBs
NCBI-GeneID: 105422302
NCBI-ProteinID: XP_011629919
Position
Unknown
AA seq 631 aa AA seqDB search
MSTTDTPKVASRRRLNPAVLARYDCQKNQESQQIQTKRELFFKGDGAGIISSPSVPSVPP
PQPPTQTPGSQVNNSVANATTTSSLTSPNTAPVYSSGGGLTGLNAKSRLPSAATTTIPND
ASEDSNRRESARTAISSKEDSNKETSLLHHARPTPPIKPKELDGYVGFVNLPNQVYRKAV
KKGFEFTLMVVGESGLGKSTLINSMFLADIYSAEYPGPSLRIKKTVAVETSKVLLKESGV
NLTLTVVDTPGFGDAVDNSNCWVPVIDYIESKYEEFLNAESRVTRRQIPDSRVHCCLYFV
APSGHGLKPLDVEFMQRLHDKVNIIPVIAKADTMTPDECAHFKKQILNEIAQHKIKIYEF
PEVDEEEEDNKFHKLLRDRVPFAVVGANTVVEHDGKKVRGRKYPWGVAEVENLEHCDFIA
LRNMVVRTHVQDLKDVTNNVHYENFRCRTLAGLGVDGKPTKASNNLCPPGVMNSFMTVWN
PLAQLEEEKREHDNKMKKMETEMEQVFEMKVREKRQKLKDSEADLQRRHEQMRRSLEQQV
RELEEKRRAFEAEKTAWEQQTGHSIEELRRRSLEANSKETGSVSSEGSGGGGGTLRGSRG
IGSLLRRHTSFKSPQDSPAQIQLVIQHPEHP
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaacggacaccccgaaggtggcgtcgagacgtcgcttgaatccggctgttctc
gccagatacgattgtcagaagaatcaggagtctcaacagattcagacgaagcgtgagctg
ttctttaagggcgatggcgcgggaataatctcgtcaccgtcggtgccgtcggtgccacca
ccgcagccgccaacgcagacccccgggtctcaggtgaacaattcggtggcgaacgccacg
acaaccagcagcctcacgtcgccgaacacggcgccggtgtactccagcggcgggggcctg
accggactcaacgcgaaatcgcggctgccatctgcggcgacgacgacaatcccgaacgat
gcctcggaggacagcaacaggcgcgagtcggcccgtaccgcgatctcttccaaggaggac
agtaacaaggagacgagtttgttgcaccatgcgcggcccacgccacccatcaagcccaag
gaactcgacggctacgtcggcttcgtgaaccttcccaatcaggtgtacaggaaggccgtg
aagaagggcttcgaattcacgctcatggtcgtaggagagtcgggacttggcaaatccact
ttgatcaactccatgttcctggcggatatatatagtgccgaatatcccggacccagtctc
aggataaagaagacggttgccgtggaaaccagcaaagtactgttgaaagagagcggcgtc
aatctcaccctcacggttgtcgatacccctggtttcggtgatgctgtagataacagcaac
tgttgggtgcctgtaatcgattacatcgagtcaaaatatgaggagtttctcaatgcagag
tctcgcgtaacgagacgacagatcccagatagtcgggtgcactgttgtctctatttcgtt
gcaccctccggccatggactgaagccgctcgacgtagagttcatgcagcgtctccacgac
aaagtaaatatcatacctgttatcgccaaggcggacactatgacgccggatgaatgcgca
catttcaaaaaacagatcttgaacgagattgcgcaacacaaaataaagatctatgaattc
ccggaggtcgatgaggaagaggaggataacaaatttcacaaattgttaagggacagagtt
ccgttcgcggtcgtgggggcaaatactgtcgtcgaacacgacgggaagaaagtacggggc
agaaaatatccatggggagttgcagaagttgagaacctggaacattgcgactttattgcg
ctccgaaacatggtagtaaggacgcacgtgcaggacttaaaagacgtgacgaacaacgta
cactatgagaacttccggtgtcgtactttggccggtctaggcgtagatggcaaaccaacg
aaagcctcgaacaatttgtgccctccaggagtgatgaacagtttcatgacggtgtggaac
ccattggcgcagctggaagaggagaagcgtgaacacgataacaagatgaaaaagatggaa
acggaaatggaacaagtcttcgagatgaaagttcgtgaaaagaggcaaaagctgaaagat
tccgaggcagacttacagagaaggcacgaacaaatgcgacgctcgttggagcagcaagtg
cgtgagctggaggagaagagacgagcattcgaggcggagaaaactgcctgggagcagcag
accggccatagtattgaagaattacgtagacgcagcttagaagcgaattcgaaagagacg
ggatcggtgtcctccgagggatctggaggcggcgggggtacgttgagggggtcccgaggg
ataggcagcctccttcgccgtcacaccagtttcaaatcacctcaagacagccccgcacag
atacagcttgtcatacagcatcctgagcacccctaa

DBGET integrated database retrieval system