KEGG   Pogonomyrmex barbatus (red harvester ant): 105422359Help
Entry
105422359         CDS       T04903                                 

Definition
(RefSeq) selenide, water dikinase-like
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00450  Selenocompound metabolism
pbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    105422359
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pbar03016]
    105422359
Enzymes [BR:pbar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     105422359
Transfer RNA biogenesis [BR:pbar03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    105422359
 Prokaryotic type
    105422359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C
Motif
Other DBs
NCBI-GeneID: 105422359
NCBI-ProteinID: XP_011630003
Position
Unknown
AA seq 90 aa AA seqDB search
MPMIARMCATAKITGNTLPLLQGEAPEISGGLLVVLPREQAVAYCKALKMIEHRQAWIVG
IVENGDRTARLIEKPRVIEVPAKDNGVSLW
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgatcgcgaggatgtgcgcgaccgcgaagatcacggggaacacgttgccgctc
ctgcagggtgaggcgcccgagatatcggggggattgctggtggtgttaccgcgagaacaa
gcggtcgcctattgcaaggccctgaagatgatcgagcacagacaggcgtggatcgtcggg
atcgtcgagaacggcgatcgcacggcgcgtctgattgagaagccgcgggtgattgaggtg
cccgctaaggataacggtgtctccctatggtaa

DBGET integrated database retrieval system