KEGG   Pogonomyrmex barbatus (red harvester ant): 105424302Help
Entry
105424302         CDS       T04903                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbar01001]
    105424302
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pbar04131]
    105424302
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pbar04812]
    105424302
   04147 Exosome [BR:pbar04147]
    105424302
Enzymes [BR:pbar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105424302
Protein kinases [BR:pbar01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   105424302
Membrane trafficking [BR:pbar04131]
 Others
  Actin-binding proteins
   Others
    105424302
Cytoskeleton proteins [BR:pbar04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     105424302
Exosome [BR:pbar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105424302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig Titin_Ig-rpts V-set C1-set C2-set_2 BiPBP_C Acid_PPase
Motif
Other DBs
NCBI-GeneID: 105424302
NCBI-ProteinID: XP_011632756
Position
Unknown
AA seq 10657 aa AA seqDB search
MKRQQFQEQQKHQQQQQQQAVMQEQQQQYIQQRTERQITRQQITSQQRVQGEIVMQTTPT
VPVFTGKPGDPSPPIFERIFKNARFAQGGNAIFEGCVRGNPRPTVSWIHKGVSLLESRKI
RMSYDENTGIVTLQINQIGPGDEGEYTCSAKNQYGEAICSVYIQPEGFDLPTKQLTDNYK
KEFTQSFQSSEQKMQTGSQVFQRSYQQTIDKQSYVNGTITSIQDFKVDTFEYRLLRESEF
RDSITRRFAGESDLQVSTIIDRTLGPIAPPQITQKPRNSKLVEGSDAIFTAKITGNPKPR
LTWFKNGQRIRDSQRVETSYSNQQATLRIRVALPEDSGHYTLLSENPQGCTVSSAYLAIE
SSDQVDQVPYQTTHQRDFIKTQQAESVTESTDSSKVLPPNFVRTITDKEATEGKMTRFDC
RVTGRPYPEVTWYINGQQVANDMTHKILVNESGNNSLMITNVSRVDAGIVTCVARNKAGE
TSCQCNLNVIEKEQVIAPKFVERFVTTSVKEGEPVVFMARAVGTPIPRITWQKDGVPITP
SSEIRISSDDSGASTLDIPCAKFSDAAWYQCTAQNIAGSTATRARLFVETPKGTTPEPRR
LNLPRPTKVIEPEPAPGPEVIYLRHVERAKPYLPPPEEDKIYPPPRFIIPLKDVHQIEGG
RIHFEARIEPVGDPTMRVEWYVNGRALDASSRATSVFRFGFISLDLISIVLQDSGEYLCR
VVSSTGVAESRATLSVTARATIEQASQHPDSLQYIQQLEDYSRYQRQESVEETSSQRPVF
IRPLQDLGELQEGRNAHFEAQLTPVSDPTMKVEWYKDGKPITASSRITSIFNFGYVSLNI
MHLRAEDAGSYTVRAVNRLGEAVSTATLRVFARTSVTTDLGIPEQSRYIEAAEELEAYQQ
AMHQKYVQEQPEPSSPPEFKSPIKDQSGIREGGFAHFEARLEPINDADLRVEWLKDGRSV
EASSRITTFFNFGYVALTIKYVTIHDVGVYTCRAYNRAGEAHTTAQLSVISKNDVIYDSQ
HPTGLQKIQSLEDSSRYARQVQEETQITQTPRFLGNLKGTNKIVEGQRAHFEARVEPQSD
LTMKIEWYHNGKPITAANRIQTYHDFGYVSIDILQVRSEDTGTYTVVARNARGEARLSAT
MTVETRSSIDTSSMHRGTYEKTQRLEESKFVEPQYHIEEISKSKPIFIQPLSDPKPVSEG
KNIHLECRLEPMGDPTMRVEWFQNGRPVTVGSRFRTYYDFGFVALDIVHATIYDSGEYTV
RATNHLGTAHTSACVRVIGRSDILTETQNEQSLEQIQMLEDTSRYRKTQQEEVTVMQAPQ
FTRPLHNIETVELTNVHLECRLQPVGDVTMKVDWFVNGRPVKTGHRFRPSYEFDYVALDI
LGVYPEDSGVYTCQARNQLGEAVTSCSVRVHAKKDLLLESQHPEGLERIQYLEDASRYKR
HELIDEVVNVKPKFITKPKNQENLREGQHAHFECKLEPVTDPNLKVEWFKNGRPVTIGHR
FRPIHDFGYVALDVIDLIAEDSGTYTCRAVNLIGSDEVLCTLTCRSSAQILTDTQNELGF
EQIHYLEDKSKYHRQEVIEETTTQAPIFTTSLNNVEIKEGQRAHFECRLIPVSDATMKIE
WFHNNKPVKAGSRFIETNSFGFVALDIMYAYPEDSGTYTCRAKNIIGEAITSATAIVHSK
KSIYTETQSEETLQRLRSLEDTSRYQRKTATEEIITQAPVFTMPIKDLRVAENQAAHFEA
RVIPVGDPKLRVEWLRNGVPISASNRVTTMHDFGYVALNMKYVNPEDSGTYTCRATNELG
EAVTSATLFVQSKAALQFESQHEGALSKLQALEDTTKYQRREEEEIVVKDKPSFTVQLNG
PTNLIEGQSAHYECRIEPYPDPNMKVEWFHNGKPLSTGHRYRTICDFGFASLDVLTVYAE
DSGTYTCQATNKLGSAKSSINLDVKSRASIIRDTQHESALKKIQYLEDDSRYKRVMEEDT
IIAEKPTFGRPLKNIEHLPEGKSAHLEATLTPVNDPTMIVEWFRDGRPIPQGHKFKTTYD
FGYVALDILYAYPEDSGTYMCKAKNAIGEAVTTCVISVDSKQGLYLDTLDAQRLQKIREL
ETIEVKEEVEKEIIHQKPIFLTPLNNLDHTHTHTHTHTHTKXLYXSIDXIFEYTVXFNRF
VNGVAIKTGHRFRTTHDFGYVALDILYTYPEDSGTYMCKATNLAGEAVNTCTIKVSSRRS
ILLDTQHPDGLEKIRELEAQGHPARLEIEEPPVTPPRFITELRGTTEVYEGQTAHFECQV
EPLHDANLRIEFFHNGKPLPSAARFHVTFDFGYVALDIGHAVPEDAGQYSVRAINTLGQC
VSSIELKVIPRDNIILDSQRPEGMDKIRELEAQQPWKRPDVPEPQTRQRPVFTQPLQNID
NIAEGHTAHFECRLIPVGDPMLKVEWFRNEVPLETSSRITKVHDFGYVSLDIAHVRDEDE
GVYMCRASNPLGEAVTTASMKIKTKASIQLDTQHPEAQRKIAQLEAKETGRPEEPEKIFD
KPIFTQLLTGPTELWEGQMARYECRVVPVGDASLKFEWYMNGIELKMGSRFHVNHDFGYV
TLDILKVIPEDSGVYTCKAINNAGEAVSSISLKVKARSAIDSDSIQADAWQKIQLKEAEM
NKVPEMFVDTTPQQAPVFTKHLESFDKLIEGQRVYLEAQVEPRADPNLRVEWFKNGISLQ
TGTRLRSTFDFGLVTLSINGLRPDDSAIYTCKATNLLGEAVSTCSLKIADRHWLLGDTLH
PDALSKIDALEQPQIISTEQPEPTYEEPVFITHLNNVECIEGDNAHFECNVEPSKDPTMK
IEWFLNSKPLPIGARFKSTYDFGYVALDLTHAYEEDSGVITVKATNSKGSAQTSGTLKCT
SKQNIYLQTQHPQGEAGFEKVKEAEDAYLSKYKKPEDSPEHEYPKPIWTVPLQSEFKLGE
SEPLHLEGQVEPKDDPNLKIEWYFNGKPLEHGSRFKMTSDFGFVTLDLTDVYERDSGIYT
CKAYNKAGEAFTSTTVYCSTKENIIEKSQHPKGKEGLEAIQDLEESLKRQEGISPGEEEG
QPPMFTSQFENLSNLSEGEIAHFEASLIPTGDQTMVVEWFYNGKSLEASHRTRTVYAFGM
VVLEVLGTKIEDSGTYTCRATNKWGKAEISVQLECIDKSKGQKPKFTTQIQSLEGLKDGQ
SAHFECTLIPVGDPHMKVEWFHNGKPLRHSSRFKMVSDFGFVVMDIAGVMSHDSGEYVCK
ASNKYGEDYTKASIKCFGKSGVYLDSLQPDSLARIRELESYAGEQATTPTTPIAEPPKFI
TQIVDITKLIEGQSAHFEAKLTPVNDPDLKVEWYYNGKKLPHGHRYRTFHDFGIVILDIL
YCYEENSGVYECKAVNKYGEDSTRAMLKCFSKANLVLESQLPKGMEGGLEKIQNLEDSMI
RTKDEKIIEERGKAPMFTVPLSNIDGLREGESAHFEARLIPTDDPKLKVEWFWNGKPLRT
GSRFRTFCDFGFVILEISPIYPEDSGEYSCRATNDYGEAVTTCTMKCTGKRSIILESQLP
KGMESTIDKIAELEGLGAVPGQISPEDDTGRPPEFITTPSDLTLAENSLAHFECRLQPIN
DSSMRVEWFHNGKPLLAGSRVKTIHDFGFVILEVANCYQRDSGLYTCKATNRHGEATVSC
KLQVRGRQGIILEPQLPSNFKTGTESIQKLEESLYKKDEILAEEETPNPPRFIVELKDIE
VEEAGPSHFDCRVEPVGDPTMRIDWFHNGRPFATGSRVHQINDFGFISLDMSYTYARDSG
EYVCRATNKWGTATTKATITCKSKKTIDFDSQLPMGMSGEKLKELERGPVSQAPAEEAPR
QPPHFITQIQSTTVDEGEPVRFECRVEPKEDPNLRIEWYRNGKLIPAGHRYRTVYDMGFV
SMDILYVYPEDSGEYVCKAINDLGEDITRAAVSCKKLPSIILQNQVPKGMKRSEALMQME
ATIKKYTSEIHLTEDDLYDADKKQPPRFVTQIQDQTDLIEMNSTKFECQLAPVGDPNMKV
EWFFNGKPLPHKNRFTPIYDFGYVAMNFGWVYPEDSGEYLCRATNLYGMDETRAIIRTAG
KPGIIYESQLPKGMKSIEKIREMEAAWQIVPEEEGEEEKVRSAPIFVSKPEAVTVEEGDW
SRFCCRVTGHPRPRVMWIINGHTVVNGSRYKLTYDGMYHLDIPKTRQYDHGKVEVIARSS
VGEARTETTLTVKQRSDDYRGVLKNSPRPWYDYGLTQYQTERQNTELERVFDERHQSVSQ
GIEIATEHLGPKVIKEPETEWQKSVKSKKNEDYYNKLMNLEEEQMLKETRLREASHQFAI
PGDKVVAHSLAKGMAQKYEESLEEQPQQESVQPPPKYIKKPFVTEIDIDTERVKTSGKYP
PEPSESTVHGREVHVAKQKQTQKEVKGDVEITRKITATETTEVEHKAKTQERVVQGQVKP
AKPPIFTKKIQPCRAFEQEQAKFEVEFDGDPLPTIKWYREDFPIQNSADLQIYTFSTKSV
LIIRQVFMEDSGVFSVIAENRGGKAKCSANLVVEERRRQPGRGGTIPPSFLSTIQSTSVA
TGQLARFDAKITGTKPLDVYWLKNGKKVTADIRYKTLEEDNIYTLLILETVPEDTAKYEC
VAINSAGEARCEAECTVRGPQSLTKIVKPTTPTIEKAPTVLEPLKDQTIKEGTSVAFACR
IIGKPVPTVQWKKADKVIKPSKYFQMQKEDDFYTLRISEAFPEDEGVYKCIAKNPAGEIM
TSANLRVLAPDTADVLPKLTPLKDQIVVEGQPAQFKTQVSPTKPKPTIQWYREGALIPQS
PDFQMIHEGNNAVLLIATTYEEDTGTFTCRATTSAGTVETSAKLIVKKRKEAYYAVPAET
DANIEVDTKLGQELGSKEDIVLKSLAFGENDLPLETYFQPGDESLPWRKGRVQLRHKTRD
SLPWQKIKTKSRDSSLDKLRVFESQIKPWTEEEVTLKKIPRIVKDVAKEKLEEIDLKPTK
IEKKDIHGLNGETIKLKSVPKDKTKAKEHVTDDTVTELYKEEVDASLLKTSRRLDETVSK
KEKNEESKWKKEEIISKKIKPKTKITSEVDVVDKINFLEQEDSSLLTMSKDEKIQKIKKE
KPVIEKIKQPKPWMEEKIALKKAKPIQKEVQKETIETVDLKSSKVTKPTLQKQSLEKVDL
KSVTKEETEINICSKYVEQEDTTLLQVSTDTHDVTKLKPSKPHTNEKLIQEEKIDDKNMI
TYKEEEDTVLLKVISERETTINDKKISKRKEIPQEKLQSKSWTEEKIILKKTKPELKEIH
KKTHEKILLKPVSMTDKEIMKKKLVEKVDLEQVKTKGPQLTEKMLYHEEEDKIIVEVDKD
VESIRNMRGEEKFVKRMPYVEKEDTTILNTKTIDSIIERSKKEVLIPWIRGKKEKEKKED
QRIKLLQSTKPEVKSEEDRSTEISEIPWRRKSKSLTIQKIPEIQLVETKSEEQANLLLWK
QDEKSSTFNIIVPDKLEESIQPDSKEVSEITWQKPEKSKTVSKETLKPEVISEKVDDIIN
EDVFTERMDLPWKRAGKSIQAGEKLEDVKLIKQKAKETKPEDVILKPETEFPKDKEKKEE
ITLKSFKREKPKQKPEEVRLKPMRRIEKSEEPKSEEVILKPVKKLPKEEETKEEITLKPF
KRDKLEEKSEKVRLKPFKKKKPEQKPEEVRLKPVRGIEKPEESKPEEVVLKPVKKLPKEE
ETKEEITLKPFKREKPEQKPEEVQLKPMRGIEKREESKPEEVVLKPAKKLPKEEETEEEI
TLKPFKREKPEQKPEEVQLKPVRRIEKPEESKPEEVVLKPAKKLPKEEETKEEITLKSFK
RDKPEEKSEEVLLRPVKRIEKPEEPKSEEVVLESVKKLPIQEEETVISKPIEEAKSKEIK
LESVSTVTDRIEDKFEEKSTDVTTPWRRSKRTKKVVDFREEVTVVPIDQEESVTGIRDEK
ETIIISSEDTQDLTKSKLKLISLPHKEDRMMEEMVASKEISWRKKKHESVKIKEEKETVV
LRPVEKLSEDIEIKQVDKEERSEEIFRDDEVTELKPIQFAEQIADILEEKHEDVIKSIKT
KSKIKEIIPKEVITTIDEKENVGDVKLHGKIDMTQMEDYKRKRKQQTQVDISIIDKDKTI
APRFIQKLQPVIAELKNPAKFTCTVIGNPFPEISWYKNEQELHASERYTMTIFETTATLE
ITKVKEEDAGMYSCRASNPAGVATSTVNLVIFEKEEEGIAPHFSTPIKPLMIEEHTPALL
ECVVTGVPVPEVKWYRGEKEIKPNERIKMTFNPTTGEAKLKILEPVPEDETIYRVRAVNK
YGRAECRTNLVISNIVKVSKPAVLRAPRITRPLLALIAEHGKPLKLLADFEGIPKPEVKW
FRNGIEITPTDKYKINIYDNTAELNINEVAKKDTGKYEIRVQNKAGEARSSSSVTIKERK
DTTSEVKAPMFTKSIQPQLVAEGEVVIMETGVESYPAASFQWFHESKPLESTPQVRIVTQ
ENRSILMVKEVTPELAGSYTCRAENVGGSVTCTATVNLTETAWEEAIELISPTFVKRLSP
VRVMDGESVNLTCVVEGKPTPRVDWYHNNKSIKEGKEIVIVQDIEGICSLSISEVFPEDA
GEYTCRAINPIGEAVCTSSLVVEAYEYVPDSEIASSVIATSLTTGQSESEEDLLSPKEIP
IFDTDIEESAPEIIKKLPQLVPIKDGELTRLEVKMKGKPKPKGKWYKQGVEIVSSQEFQI
EEFEDGTSVLTIAETFPDDTGEIIFEAHNPLGVSTTTAYLSVEGILGTKEYRKPEWVTQM
EEMQEALKGKIGFILYVCIIFAIYIFRKIVDIEETQFLETTEFIEDKSEEISRARRIIPI
QEPIITEATTSLKKIDDQKSREHLPKVEKRAKRIVEEQESIIVSEITSEDTAPDFTIETK
LDSAQITSETLQKVSVTEAHVESSVLETKHTEVKQKKAKKIKAEKIEEDITVKEIVQQQK
ENIAREVDEIMEMLDAKEFGPGEFPLRELAIIGYLVRQGVSVNEINQCLYRTEIFPALKT
PDAQNALVQLVERKGHGPLITQVLTEETTTDESFVAATVGFRAFMRMVELQHATVEEIIT
HFAPDDFKPRAWEVTEISEVETEQHAMDSVDVVHKTEVYFMEKRDERKATQDIREIKEYE
DTRQAHTTLRKRKDRKPKDQIEETTQDREEGVQIVKIEEVEEIEKERKKEEIEEEIIELE
RDSKGRLIYKQKXQDIQEQVDVEEEEDTIENVRKTLTPKRPNIGQDEIQLEEIEEFEIIK
EPLLPSIALNVSSQRNQIIPLDHIIEQAPGKPESTKAKYTLDTVLALTEQTMSVHEKEID
QVTIIKPIERKASISISSIEPYSTVETTAHISTDEFSDTFKAASFEATSMIITKESLLIS
ETMTHDDNISSLTLITPEMSRNANVQVTVQEATSVRETIVNQSEIPTEDFITPLSVTAED
IVLPQISLSVYEIQEGLAEDKLESAKTMFTKPRINVNAIEPLMVEEIHSEDKPGKYYPEL
IVPTEVATETIISQKQRITEEMNAPEKEGTYIPGKLPPSQMAQIGITYGNETAVIRHDFV
QEREGEYIPDHKIDSFEATPNITVLEGVTISTIDTQQKEDDLTIEQSKHITADLNVVEII
SAVTIETMTSEKEQDYHNEEKPTTKSAITSISSLEIGSITDTIVQESEGSYSVDQKPCGV
LAETSVRPEEHILISQIQTADYPADLKDTLKYISESGTISVQLTEAKTILETLAHDQETT
MKEDVTPETHTIETIYDVVRGIEISQTTSIEKEADLKIFEMPESHRGKTVPTHPMISLEV
QETQPENNLGEVIKDALSIATAKIGAIGLQEMIVGETIVAEDVAPARKDKGPETTTAVIS
MNQIESLHTTMVIAGEKESEYIEATDVKDAFANTEYMTQVVPICEQVRTESPTEEYLAVD
KPISGKAYTSHIPIETISVAMQETAEKEEIYKADTKPEGRIANIELTEMKPGASVLEIIP
HDLENIYTPDTGPQTHMVESSITGHTIASKAEVIVEQSAGKISSDIPKSGKAIIQQEALE
ELIITETNVSEAERVREEDTRPIQQNAAVEVCARSEKLTVTEVTTILKEEELPMDKLPNE
RRVILDITEGREIAETQEMILANNISELKEEKPNQESANQLQNGLDVVQQMEVSISEKES
PLKMDVKPDVKNIGISFQEGESLTIEITHPEDKEDVLDEKQVPKTAEATINVITHNIASK
FEIVSNVTPIELSTEFTQEARPKATLLPFETAIAEEVQTRETEKAFFHMPAPEKRANLEF
IIGEGLVVSSVTASDKESIFAEIEKPQLKSASFDIPAHIVAEAVEVTATDNIRELIHEET
ISAMATTEHITHSSIVTSDMSVGDSEQPMLDFITPDKKRVDVSFEEETSVTVIETIASDK
EREYLKKLNIPSEQITTSFDAHKIAELTEITPAIYPGDLDVKAPMSAAAKEERLPFESIV
QSETVATETEIEFKDKPTKTDTAHISVDEIISATMFTEIPGEKEDILRIPKKPIEKKAEV
QFTGHVIAEKSEVNPASSAGILMETKPTSITAILSSIPLEAVVQTETQPTEAEATLGKDK
IPSMTEADLSMIVEQSIEISSVILEDKETEYRPKETPKPRTAEKALIETHGVAETIMQIP
DFSTGEIATGEIPLAAVAIPDHIVFNPLVESQPVIQEKEKEFVPTLMPENKTINIDMQEG
KAIVSIAHVTPIDKESPYVIEEQPRKHAASFNINATHGIAETTAVAVEHSIGKVTIEKPD
IKTVSSTHEVHQSLLVTEGISQDREKPFEDKFMPEMHKTELSVEEGKRVTSVTEIKIADK
EAPLKMVLEDRTHLALSVITPGHEVAERSEIILNSSTGEINEVIAPTKITALINQKPFET
VQLTEQIPIEKEVDSIRETPLTKTSARVVLDENRFVAITESITAQDVEEEFATKKLRQEA
ANLLMEGKEVAERTEINLREGLGELPVTSEPIICEAHRIQSTLESIDVIETISQEQGTAF
FDKFKPNTCNVDIRFVEGKSITVDHVVAQDKEKTINIPRYEESTARIKLTKAGMDVAQKA
QIFVEQNIGSVKPLEKIQAEAHIKQDEFQSIIIQEVPSAESEDTFNKYPKLILSTAVPKF
EEGHSVFITEVTSGEVEESFEEKKHKTSQIAIRSIVTERDSIETTMVESRVNVPEQLPDR
TSVPQVATPAQDMFESIIINENLIEESEKTFDSLFKPMTQKANINITEIKPLQISETIIE
DKEKVLDIATKHSEVKATPGIDLFQTIEGSFVESIQSTQELYEDKPLSSQATISQTTMET
IVNVETTTAEKEDIFKSTFQPEKQKGNPQFEGLTTVVITEIASNEIENILPEVVPPKQHQ
AQPNLTSKEAAEILQIVTANTTQDLAETTKLYEQRGKSEFEELSSLTISEIVSNEVEDVL
ISKITPKDCKADFNVSGREAAETIQVTTISETNELAIKGPEEQKSSQQINELIPLTISQV
ISNETEETLISTEFPKRKIAQPNLFGRDIAETTLVLTMTSAEEFIPKKETEKQKGKPTLE
ELTPLMISQIESQEIESVLASPKIPIKRMAQTSLYGRDIAETMEITTVLNVDKFVELQKP
EVQKGKPNLEELLPLNVMQTVSNETETFLLSPDIPVEKIAQANLSGRDIAETSQILTMIS
TEELSQQIAPNERKGEFKVEELSSLTISQVLSHETEETFQSPDVPSLLTAMPTMSGREIA
ETSQVLTVTNTEEFSRPKSPIGQEGKPRVDEFSPLTVSQIISIETEEQLPNLERLDEKIA
KPCLSGREIAQKIEIVTASTVKQIPEVKKKEDQKGKLDIEEMNFIIMSEVISTEKEQELP
SYQEIPKEGKALPKILSREVAEILEILPVSTVKELAKMQISEQQKGKPNLEELMPLLIFE
VPYNEAEKELPTLNEPTRQVAEESMLSMRVAEKSQTIPSLTTDEMIETAKPLIKKITPKQ
IPYESIQQTESIPHEKERLLVSDKQTSSATADISFRISEGIEVIQVTTTEKEVKEIVKSL
EGTHQTAEQSMLSMPVAQKSQVIISSTTDEIIESAKPEXKKIMPERVPFDSIQQTESIPH
EKECLLVSDKHTPSATADISFRVSEGVEVIQVTATEKEAQEVAKRVKETTKQTAEQRMLS
MPVAQKSQVVTSLTTDEIIESIKPEMKQIIPEQVPFESIQQIESIIHESECSLISDKRRT
PSTIADVSFRTSEGVEVIQVTTTEKEMKEIKELEETPNQKAQQSMLSMSVAQKSQVFPTL
TTEEITESAKPEIKKIIPEQIPFEGIQQIEAILHESEGSLSPDKKTPSTTAEVSFGVSES
VQVIQVTATEKETKDVIKNLEEATQQTAEQSMLSMSVAQKSQVFPTLATEEXIESVKPEI
KKIIPEQIPFESIQQIESILHESERSLHPDKKRPDATAEVSFHVSEGVEVIHVTAAEKET
KEAVKILEGVIKQTAEQSMLSMPVAEKTQMVTSSTTQEIIEFPKPELKTIIPEQIPFEGI
QQIESISHESERSFTPDKKMSSTTADVTFCISEGIEVTQVISTEKETKETVKSLGEATKQ
TAEQSILSMPVAQKSQIIASSTIEEILESIKPEVKKIIPEQIPFDSIQQIESIPHEKERL
LVSDKKTPSAIADVAFRTSEGIEVIQVTATEKEQKMS
NT seq 31974 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgacaacagtttcaagaacaacagaagcatcaacagcaacaacaacaacaagct
gttatgcaggaacaacagcaacagtacattcaacaacggacagaaagacaaataacgcgg
caacagatcaccagtcagcagagagttcaaggggagattgttatgcaaacgacaccaacg
gtaccagtatttacgggcaagcccggggatccctcaccaccgattttcgaacgaatcttt
aaaaatgcaagattcgcgcagggcggcaatgcgatttttgaaggttgcgtccgaggtaat
ccaagaccaactgtctcctggatacataaaggagtatcgttgctagaatcgcggaagatt
cggatgtcttatgacgaaaacactggaattgtcacacttcaaattaatcagattggtcct
ggggacgagggcgaatacacgtgcagtgcaaaaaaccaatatggcgaagctatttgctca
gtttacatacagccagaaggatttgatcttccgacaaaacagctgacggataattacaag
aaagaatttacgcaaagcttccaatcgagcgaacagaaaatgcaaactggaagtcaagtc
ttccaacgcagttatcagcaaacgatagataaacaaagttacgttaatggtacaattacg
agcattcaagattttaaggttgatactttcgaatatagattgttgcgtgaatcggagttt
cgtgattcgattactcgtcgtttcgcgggtgaatctgatttgcaagtttctacgataatt
gatcgtaccttgggaccgattgcacctccacaaatcactcaaaaacccagaaattcaaaa
ctcgttgaaggatcggacgctatctttactgcaaagataactggcaatcctaaaccaaga
ttaacatggtttaaaaatggacagagaattcgagattctcaacgtgtggagacaagttat
tcaaatcagcaggctactttacgaatccgagtcgccctgccggaagatagtggtcattat
acattgttgtctgagaatcctcaaggttgtactgtcagttccgcttatttggcaattgaa
tccagcgatcaagtagatcaagttccatatcaaaccacacaccaaagagattttattaag
actcaacaagcagagtcggttaccgaatctactgactctagtaaagttctgccgccaaat
tttgttcgtaccattacagataaggaagctaccgaaggcaaaatgacgcgattcgactgt
cgcgtaactggtcgtccctaccccgaagttacttggtacataaacggccaacaagttgcc
aatgatatgactcacaaaattcttgtaaatgaatctggtaacaattcgttgatgatcacg
aacgtgagtcgtgtcgacgctggcatagtaacgtgcgttgctcggaataaagctggcgaa
acttcttgtcagtgcaacttgaacgttattgaaaaggaacaggtaattgcaccgaaattt
gttgaacgcttcgttacaacaagcgtgaaagaaggcgaacccgtagtctttatggcacgc
gcagtcggcacgccgattccacgtatcacgtggcaaaaggatggtgtaccgataacgccc
agttctgaaatacgtatatcaagcgatgatagcggagcttcgactttagacatcccatgt
gccaaattctcagatgcagcctggtaccaatgcacagctcaaaatatagccggttctact
gcaactcgagcacggcttttcgttgagacaccgaaaggaacaaccccggaaccaagacgc
ctgaatttaccccgaccaacgaaagttatcgaaccagaaccagcgcctggtcccgaagtg
atttatttgagacacgtggaacgcgcgaaaccttacttgccccctcctgaagaagacaaa
atttacccgccgccacgtttcatcataccattaaaggacgttcatcaaatcgaaggtgga
cgaattcacttcgaggccagaatcgaaccggtgggcgatcccaccatgagggtagaatgg
tatgtcaacggtagagcactcgacgcgagttcccgagcgacttctgtctttcgctttggt
tttatttcactcgatctcattagcattgttttgcaagatagcggggaatatttgtgccgc
gtcgtaagctcgaccggagttgccgaatctcgagccaccctcagcgtgaccgcacgcgct
acgattgaacaagcgagccaacatcccgacagccttcaatatatccagcagctcgaggat
tacagtaggtatcaaagacaggagagtgtagaggagacttcttcacagaggccagttttc
attcgtccgcttcaggatcttggtgaactacaggaaggtcgtaacgctcattttgaggca
caattgacacctgttagcgatcctaccatgaaagtggagtggtataaagatggaaaacca
attacagccagctcaagaattactagcatcttcaacttcggatacgtctcacttaatata
atgcacctacgggctgaagatgcaggttcttataccgttagagctgtaaatcgtttggga
gaagccgtcagcactgcaactcttcgtgtctttgcgcgtacaagcgtaacaacagacttg
ggtatccccgaacaatcgagatacattgaggccgccgaggaattggaagcctatcaacag
gcgatgcaccagaaatacgtgcaggagcagcctgaaccgagtagcccgccggaatttaaa
tcgcctattaaagatcagagcggcatacgagaaggcggatttgctcattttgaggcacgt
ctcgagccaatcaatgatgctgatctccgtgtcgaatggctgaaagacggacgatctgta
gaagctagttctcggattacaaccttcttcaatttcggttacgtggcgttgaccatcaaa
tatgtaacgatacatgacgtcggcgtatatacttgccgagcctacaacagagccggcgaa
gctcacactacagctcaattaagtgtaatcagtaagaatgatgttatttatgatagccag
caccctactggtctccagaaaattcagtctcttgaagattcgagtagatatgcgcgacag
gttcaggaggaaacgcaaattacacagacacctcgatttttgggtaatcttaaaggtacc
aataagattgtagaaggtcaacgagcgcattttgaagcacgcgtcgaaccacaaagtgat
cttactatgaaaatcgagtggtatcacaatggcaaacccattactgctgctaatagaatc
cagacgtatcacgatttcggatacgtttccattgatattcttcaggttcgttctgaggat
actggcacatacaccgttgtggctagaaatgcccgcggagaagctcgtttatccgccact
atgaccgtagagacacgttctagtatagatactagtagcatgcaccgtggcacttatgaa
aagactcaacgtttagaagaatccaagtttgtcgagccacagtaccacatcgaagaaatt
tctaaatcaaaaccgattttcattcaaccattgagtgatcctaaaccagttagcgaaggc
aaaaatattcatttggaatgtcgtttggagccgatgggcgatccaacgatgagagttgag
tggttccaaaacggacgtccggttactgtcggttctagatttaggacttactatgatttc
ggattcgttgcacttgatatagtgcacgctaccatttacgattctggcgaatatacggtc
agagccactaatcatttaggtaccgcgcatacttctgcttgcgttagagttatcggtaga
tctgacatccttaccgaaacgcaaaatgaacaatcacttgaacaaatacaaatgttggag
gacacatcaagatatcgcaaaactcagcaagaggaagtcactgtaatgcaagcacctcaa
ttcactcgacctctgcacaatattgagacagtagaactgaccaatgttcatcttgaatgc
cgtcttcagccagttggtgacgtgaccatgaaagtcgattggtttgttaacggtcgacca
gtcaagactggtcatcgatttaggccatcttatgaatttgattacgtagctctagatatt
ctcggtgtatatcctgaagattctggtgtttacacctgtcaggctagaaatcagctcggt
gaagcagttacttcatgctccgtaagagtacatgccaaaaaggatttacttcttgaatct
caacatcccgaaggattggaaagaatacaatacttggaggatgcttcacgatacaaaaga
catgaattaatcgatgaagttgtcaatgtaaagccaaaatttattactaaaccgaaaaat
caagagaatcttcgagaaggacaacatgctcattttgagtgtaaactggagccggtaaca
gatcccaatttgaaagtcgagtggtttaagaatggtcgtccagtgacaataggacaccgc
ttccgtccaattcacgattttggttatgttgcattggatgtaattgatttgattgccgaa
gactctggaacatatacctgtcgtgctgttaatctaataggcagtgatgaagtactctgc
actttaacatgtcgctcgagtgcgcagatattaacggacacgcaaaatgaacttggattc
gaacagattcactatctcgaagataagtccaaatatcatagacaagaagtaattgaagaa
actaccactcaagcgcctatttttacaacttcattaaataacgtcgaaatcaaagagggt
caacgagcacactttgaatgtagactaattccagtgtctgacgcaacgatgaaaatcgag
tggtttcataataataaacccgtgaaagccggctcgaggtttatcgaaacaaatagtttt
ggtttcgtcgctctcgatatcatgtacgcataccccgaagactctgggacatacacttgt
agagctaaaaatattattggtgaagctattacttccgcaaccgctattgttcattctaaa
aagtctatttacacggagactcagagcgaggaaactcttcaacgtcttcgttcattggag
gatacgtctcgttatcaacgtaaaaccgcaaccgaggaaattattacgcaagcgcctgtc
tttacgatgccgataaaggatcttcgtgttgctgagaatcaggcagcgcacttcgaggca
cgtgttattccagttggagatcccaaacttagggtagaatggctacgtaatggtgttcct
atttcagcttcaaatcgtgtaacaactatgcacgactttggatacgttgccttaaatatg
aagtatgtcaatcctgaagactcgggtacttacacgtgccgtgccacaaatgaacttgga
gaagcagttacttcagcaacattatttgttcaatccaaggcagccttgcagtttgaatca
caacacgagggcgctttatcgaaactccaagccttggaagatactacaaaatatcaacga
cgtgaggaagaagaaatcgtggtaaaagacaagccatcctttacggtgcaattgaatgga
cctacaaatctaatcgaaggtcaaagcgcacattatgagtgtcgcatagaaccttatccc
gatcctaacatgaaagtggaatggttccataatggtaaaccattatccaccggtcacagg
tacagaactatctgtgattttggattcgcatcgttggacgtattgaccgtatatgctgaa
gattcgggcacatatacttgccaagccaccaataaattgggatcggcgaagagctcgatt
aatcttgatgtaaagtctcgagcatcaattattcgtgacacgcagcatgaaagcgcatta
aaaaagatacaatacctcgaagatgattcaagatataaacgtgtgatggaagaagatacg
attatcgccgagaaacccacttttggacgaccattgaagaatattgaacatctcccagaa
ggcaaaagcgctcatctcgaagctacactgactcccgtaaacgatccgacaatgattgtt
gaatggtttagagatggacgtccgattcctcagggacataaatttaaaacgacctacgat
tttggatatgttgctctcgatattctttatgcttatcctgaagattcgggtacttatatg
tgcaaagcaaagaacgccattggcgaagcagtcactacttgcgtgatcagcgtagactca
aaacaaggtttatatctcgatacgttggatgcgcaacgtctgcaaaagattcgcgaattg
gaaactatcgaagttaaagaagaagttgaaaaggagatcattcatcaaaaacctatattt
ttgacaccattgaacaatctggatcacacacacacacacacacacacacacacacacacc
aaataattatattagtctatcgattaaatatttgaatatactgtttaatttaataggttt
gtcaatggagttgcaattaaaactggtcatcgcttccgtacaacacatgattttggttat
gtggctcttgatattctttatacctatcctgaagattctggtacttacatgtgtaaagca
accaatttggctggagaagccgttaatacttgcactatcaaagttagctcccggcgaagc
atccttctggatactcaacatccagatggtttagaaaaaattcgagaattagaggcccaa
ggtcatcctgcgcgattggagatcgaagaaccaccagtaacaccaccaagatttatcact
gaacttaggggcacaactgaagtatacgagggacaaacagctcactttgagtgtcaagta
gaacctttgcatgacgcaaatttaagaattgaatttttccataatggtaaaccattacca
tcggcagcccgtttccatgtgacttttgattttgggtatgttgctttggacattggtcat
gccgtacctgaagatgcaggacaatattctgtacgagcgatcaacacgctaggacaatgc
gtatcatcaatcgagctcaaggtaatcccacgagataatattattctggattcccaacgt
cccgaaggaatggacaaaatccgggaacttgaagcccaacagccatggaagagaccagat
gtaccagagcctcaaactcgacaacgaccggtcttcactcaacctttgcaaaatattgac
aatattgccgaaggtcatactgcacatttcgaatgcagacttatacccgtgggtgatcct
atgctcaaagtggaatggttcagaaatgaagtgcctcttgaaacaagttcgcggattaca
aaagtgcatgactttggctatgtatctctggatattgctcatgtgcgtgatgaagatgaa
ggcgtttatatgtgtcgtgcttctaatccgttgggtgaagcagttaccacggcttcaatg
aaaattaaaactaaggcgagcatacaattagatactcaacatcccgaggcacaacgtaaa
atcgctcagctggaagccaaagagactggacgacccgaggaaccggaaaagattttcgat
aaaccgattttcacgcaattgctaactggaccaactgaactttgggaaggacaaatggcg
agatacgaatgtagggtcgttcccgttggtgatgcgagtttaaaatttgagtggtatatg
aacggaatagaattaaaaatgggatcacgtttccatgtgaatcacgattttggatatgta
acattagacattctaaaagttatccctgaagactctggagtttacacttgcaaagcgatt
aacaatgctggagaagcagtgtcatcgatttctctgaaagtaaaagcgcgttcagctatc
gattccgatagcatacaagcggacgcgtggcagaagattcaattgaaagaagcagaaatg
aataaagtgccggaaatgtttgttgatacaacaccgcagcaagcgccagttttcactaaa
catctcgagagtttcgacaaattgatagagggccaacgtgtctatttagaagctcaagtg
gaaccgcgggcggatcctaacttgagggtagaatggttcaaaaatggtatatctcttcaa
actggaacgaggcttcgtagtacgtttgattttggtctagtaactttgtcgattaatggc
ctaagacccgacgattccgcaatttacacgtgtaaggcgactaatcttttgggagaagcc
gtatcgacttgtagtttaaaaattgccgatcgtcattggttattgggagatactttgcat
cccgacgctctctcaaaaattgatgctttggaacagccacaaataatatctaccgaacaa
ccagaacctacttatgaagaaccggttttcatcactcacttaaataatgtggaatgcatc
gagggtgataacgctcattttgaatgcaacgtagaaccatcaaaagacccgactatgaag
attgaatggttcttgaacagtaaacctttaccgattggtgcgagattcaagagcacttac
gactttggttacgtagctctggacttgactcacgcttacgaagaagattcgggcgtgatt
acggttaaagctacgaattcaaagggaagcgcacagacatcaggtactttgaaatgcact
agcaagcaaaatatttatcttcaaacgcaacatccgcaaggagaagccggatttgagaaa
gtgaaagaggctgaagatgcttatctatcgaaatataagaaaccggaagatagtcctgag
cacgaatatcctaagccgatctggacggttcctctccagtctgagtttaaattaggagag
tccgaaccattacatctagaaggacaagttgaaccaaaagatgatcccaatttaaaaatt
gaatggtactttaacgggaaacctttagagcatggttcacgttttaaaatgactagcgac
tttggatttgttactttagacttaacggatgtttatgagcgtgattctggcatttacaca
tgcaaagcctataacaaggcaggggaagcctttacttcaacaacagtttattgttccacg
aaagaaaatatcatagaaaagtcacagcatcccaaaggtaaggaaggtctcgaagcaatt
caagatctggaggaatcattgaaacgacaagaaggtatttcaccaggagaggaagaaggt
caaccaccaatgtttacatcacaatttgagaatctgagcaatctctcagaaggagaaatt
gctcactttgaagcatctctcattcccactggtgatcaaactatggtagttgagtggttt
tataatggcaaatctttagaagctagtcatcgcacgagaaccgtttatgcttttggcatg
gttgtccttgaggttctcggcactaaaatagaagattcaggtacttacacttgtagggcc
actaacaagtggggtaaagcagaaattagtgtacaattagaatgtatcgataaatccaag
ggccagaaacctaaattcacaactcagattcaatccttggagggtctgaaagatggtcaa
tcagctcatttcgagtgtactctaatcccagtgggtgatcctcacatgaaagtcgagtgg
ttccacaatggaaaacctctacggcactcgtcacgtttcaaaatggtctctgattttggc
ttcgtagttatggatattgctggtgtgatgtctcatgatagcggggaatacgtttgcaaa
gctagcaataaatacggagaggattatacaaaagcctcgatcaaatgctttggcaagagc
ggagtttacttagattccctgcaaccggactcgctagctagaatccgagagcttgagagt
tatgccggagaacaagcaactacacctacgactcccattgccgaaccaccaaaattcatt
acgcaaattgttgacatcacgaaactaatagaaggacaatccgcacactttgaggcgaaa
ctgactccagtgaatgatcctgacttgaaagtcgagtggtattataatggcaagaaactt
ccacatggtcatcgatatcgcacttttcatgactttggtatcgttatcttagacatactt
tattgttacgaagagaattccggagtttatgaatgtaaagctgttaataagtacggcgaa
gattcaacaagagcaatgctcaaatgcttctctaaggctaatcttgttttggaatcccaa
cttcctaagggcatggaaggtggcctagaaaaaattcaaaatcttgaagactcgatgata
cgtacaaaggacgaaaagattatagaagaacgtggcaaggctcccatgttcactgtacct
ttaagtaacattgatggcctacgagaaggagagagcgcgcatttcgaagcacgactaatt
cccacagatgacccaaaactaaaagtcgaatggttctggaatggtaaaccattgcgaaca
ggatctcgcttccgcaccttttgcgattttggtttcgtcattttagagatctctcccatc
tatccagaggactctggagaatatagttgcagagcgacaaatgactatggcgaggcggtg
acaacatgcacaatgaaatgtacaggcaaacgtagtattattctggaatctcaattacct
aagggtatggaaagtacgattgataagatcgccgagttggaaggtcttggagctgttcct
ggtcagattagtcccgaggatgatactggaagaccaccagagttcatcacgactccttct
gatttgactttagctgaaaattctcttgctcacttcgaatgccgattacagccaattaac
gattccagtatgagagttgaatggtttcacaatggcaagcctcttcttgctggtagtaga
gtcaaaacaattcatgactttggtttcgttattctggaagtcgcaaattgctatcaacgc
gattctggtttatacacctgtaaagctaccaatcgtcacggtgaagccacggtatcgtgc
aaacttcaagttcgcggacgtcaaggtattatcctggagcctcagttaccgagcaatttt
aagactggtacagaaagtattcagaaattggaagagtccttatataagaaagatgaaatt
ttggcggaggaagaaacaccaaatccaccaagatttatcgtcgaacttaaagatatcgaa
gttgaagaagctggaccgagtcacttcgattgtagagttgaacctgtgggtgatcccact
atgcgtattgattggttccacaatggacggccttttgcaacaggctctcgggttcatcag
attaatgattttggatttatatcattggatatgtcatacacgtatgcacgagatagcggt
gaatatgtctgcagagctactaataaatggggcactgctactaccaaagctaccatcact
tgcaaatccaagaagacaatagattttgactctcaattgccaatgggaatgagcggtgag
aagctaaaagaattagagcgaggaccagtctctcaagctcctgcggaagaagcaccgcga
caaccacctcattttatcactcaaattcaatcaacaacagtcgacgagggtgaaccagtt
agatttgaatgccgtgtggagcccaaggaggatccgaatctacgtatcgaatggtacaga
aatggtaaattgatacccgccgggcacagatacagaacggtttacgacatgggatttgtg
tcgatggatatcttatatgtttatcccgaggattctggtgaatatgtttgcaaggctatt
aatgatcttggagaagatattactcgagctgctgtatcttgcaaaaaattaccaagtatc
attttgcaaaatcaagtaccaaaaggtatgaaaagatctgaagccttgatgcaaatggaa
gcaacaattaagaagtatacttccgaaattcatttaactgaggatgatttgtatgacgcg
gacaaaaagcagccccctagatttgtcacacaaattcaagatcaaaccgatcttattgaa
atgaatagcaccaagtttgagtgtcaattggcgcccgtgggtgatccaaatatgaaagtc
gaatggttcttcaatgggaaaccattacctcataagaatcgatttactcctatttatgac
tttggttatgtagcaatgaattttggttgggtttatccagaagatagtggcgagtatctg
tgcagagctacaaatctttatggaatggacgaaaccagggccataattagaactgcggga
aaacctggaattatttatgaatctcaacttccaaaaggcatgaagagcatcgaaaaaatc
agagaaatggaagcagcatggcaaatagtgcccgaagaggaaggcgaagaggaaaaagta
cgctcggcgccaatttttgtaagtaaaccagaagcggtaaccgtcgaagaaggtgattgg
tctagattctgctgtcgagttactggacatccaagacctcgagttatgtggataattaat
ggacatacagtagtcaatgggtcgcgttataaattgacatacgacggcatgtatcatctg
gatataccaaagactagacaatacgaccatggtaaagtggaagtaattgcaaggagttct
gttggtgaagcacgtacagaaacgactttaactgtcaaacagagaagcgacgactaccgg
ggtgtattgaaaaattcaccaagaccttggtacgattatggcctaacacagtatcaaacc
gaacgacaaaatacagaattggagcgcgtgttcgacgaacgtcaccaaagcgtttcccaa
ggaatcgaaattgccaccgagcatcttggtcctaaagttatcaaagaacctgagactgaa
tggcaaaaatctgtaaagagtaagaaaaatgaagattattataataagctgatgaatctt
gaagaagaacaaatgctcaaagagactagattaagggaagcttcgcatcagtttgctatt
cccggcgacaaggttgttgcacattccttagcaaagggaatggcccaaaagtatgaagaa
agtttggaggaacaacctcagcaagaatcggtacaaccacctccgaaatacataaaaaaa
ccgtttgtcaccgagatagatatagatacagaacgcgttaaaacttcgggaaaatatcca
ccagaaccatctgaatccacagttcatggccgtgaagttcacgttgctaaacaaaaacag
acacaaaaggaggtcaaaggtgacgtagaaataacgagaaaaattacagcaacggaaact
acggaagtagaacataaagcaaaaacgcaggaacgtgtagtgcaaggtcaagtcaaacct
gccaagccgccaatttttacgaagaagattcaaccctgtagagcgtttgagcaagaacaa
gctaaatttgaagtcgaatttgatggcgacccattaccgactatcaaatggtatcgcgaa
gattttcctatacaaaattctgctgatctacaaatttatacttttagcaccaaatcggta
ttaattatcagacaagtttttatggaagactctggtgtcttttccgttattgctgaaaat
agaggaggcaaagccaaatgtagtgccaacttagtcgtagaggaacgcagaagacagcct
gggcgaggtggcacgataccacctagtttcttatccacgattcaatccacttctgtagct
actggacaacttgctagattcgatgccaagattaccggcactaaaccgctggatgtttac
tggcttaagaatggtaaaaaagtaacagcggatatccgttataaaactttggaagaagat
aatatttatacactactgattctggagacagtaccagaagatactgccaagtacgaatgt
gttgcgattaacagtgccggagaagcgcgttgcgaagcagagtgcaccgttcgtggacct
caatctctaacaaagattgtaaaaccaacaacgccaacaatagaaaaagcgccaactgtt
ctggaaccattaaaggatcaaaccattaaggaaggaacttccgtcgctttcgcctgcagg
attataggaaagcctgttcctactgtgcaatggaaaaaagctgataaggtaatcaaacca
tcaaagtacttccaaatgcagaaagaagacgatttttatactctgagaatttctgaggcg
ttccctgaagatgaaggtgtttataaatgcattgcaaaaaatccggctggtgaaattatg
acatctgccaacctcagagtactcgcacctgacacagctgatgttctgccaaaattaaca
cctttaaaggatcaaatagtggtagaaggacagccggctcaatttaagactcaagtgagt
ccgacaaagcctaaaccgacgattcaatggtatcgagaaggtgccttaatcccacagtca
ccagattttcagatgattcatgaaggcaacaatgcggtgttactgatagcaactacctac
gaggaggatactggcaccttcacttgccgcgctacgacatctgccggtaccgtagaaaca
tccgccaaactcatcgtcaaaaagagaaaagaagcctattatgcggttcccgcggaaacg
gatgctaatatcgaagtagatacaaaacttggtcaagaacttggttcaaaagaagatata
gttctgaaatcattagctttcggcgaaaatgatttaccacttgaaacatattttcaacca
ggtgatgaatcgctgccttggagaaagggacgtgttcaacttcgacataaaactcgcgat
tcacttccatggcagaaaataaaaacaaaatcaagagattcttctttggataaacttcga
gttttcgagagtcaaataaaaccgtggaccgaggaagaagtaactttgaagaaaattccc
cgaattgttaaggatgtagcaaaagaaaagttggaagaaattgatttgaagccgacaaag
attgagaagaaggacatccatggacttaatggagaaacaattaaattgaaatccgtacca
aaagataaaacaaaggccaaagaacatgttaccgacgatactgtgactgaactttataaa
gaggaagtggatgctagtctgttaaaaacatcgcgtcgtttagatgaaactgtgtcaaag
aaagaaaaaaatgaggaatcaaaatggaaaaaggaggaaattatttcgaagaaaataaaa
ccaaagacaaaaataacttctgaagtggatgttgtagataaaataaattttctcgaacaa
gaggatagttctttgctcacaatgtcaaaagacgaaaaaatacaaaaaataaaaaaagaa
aaacctgtcatagaaaaaataaaacaacccaagccttggatggaagaaaaaattgctttg
aaaaaagcaaaacctatccaaaaagaagtccaaaaagagactatagaaacagtagattta
aaatcatctaaagtcactaaaccaacgctccaaaaacaaagtttagaaaaggtagatcta
aaatctgttacaaaagaagagacggaaattaatatatgttcaaaatatgttgaacaggaa
gatactacattacttcaagtttcaactgatacacatgatgttactaaattaaaaccatca
aaaccacatacaaatgaaaaattaatacaagaagaaaaaatcgatgataaaaacatgatt
acatataaggaagaagaagatactgttttgcttaaagttatatcagagcgcgaaactaca
atcaatgataaaaaaataagcaagagaaaggaaataccacaagaaaaattacagtcaaaa
tcatggacggaagagaaaataattttaaagaaaacaaaaccagaattaaaagaaatacat
aaaaagactcacgagaaaatattattgaaaccagtatcaatgacagacaaagaaataatg
aaaaaaaaattagttgaaaaagttgatttggaacaagttaaaaccaaaggtccacaatta
actgaaaagatgctatatcacgaagaggaagataaaattattgtcgaagtggacaaagat
gttgaatcaattagaaatatgagaggcgaagaaaagtttgtgaaaagaatgccatatgtc
gaaaaggaagacactacaatattaaataccaaaacaatcgatagtataatcgaaagatct
aaaaaagaagtattaataccatggattaggggcaaaaaggaaaaagaaaagaaagaagat
caaagaataaaattattacaatcaactaaacctgaagttaaatcggaagaggatagatct
acagagatttcagaaattccgtggcgtcgtaaatcaaaatcattgacaattcaaaaaatt
ccagaaattcaacttgttgaaacaaaatctgaagaacaggcaaatttattattatggaag
caagatgaaaaatcatctacctttaatattatagttccagacaaattggaagaatcaata
caacccgatagcaaagaagtttctgaaataacatggcaaaaacctgagaaaagcaaaacg
gtctcaaaggaaacgttaaaaccagaagtgatatctgaaaaagtagatgacattattaat
gaagatgtatttacagaaagaatggatttaccatggaaacgtgcaggaaaatcaatacaa
gctggagaaaagctagaagatgtaaaattaattaaacaaaaagcaaaagaaacaaaacct
gaagacgtcatattaaaacctgaaacagaatttccaaaagacaaggagaaaaaggaagaa
attacattaaaatcgttcaagagagaaaaaccaaagcaaaaacctgaagaagtacgattg
aaaccaatgagaagaatagaaaaatctgaagaaccaaaatcagaagaagtcatattaaaa
cctgtgaaaaagcttccaaaagaggaagaaacaaaggaggaaattactttaaaaccattc
aagagagacaaactggaagaaaaatctgaaaaggtacgactgaaaccattcaagaagaaa
aaaccagagcaaaaacctgaagaagtacgattaaagccagtgagaggaatagaaaaacct
gaagaatcaaaacccgaagaagtcgtactaaaacctgtaaagaaacttcccaaagaagaa
gagacaaaagaggaaataactttaaaaccattcaaaagagaaaaaccggagcaaaaacct
gaagaggtacaattgaaaccaatgagaggaatagaaaaacgtgaagaatcaaaacccgaa
gaagtcgtactaaaacctgcaaagaaacttcccaaagaagaagagacggaagaggaaata
actttaaaaccattcaaaagagaaaaaccggagcaaaaacctgaagaggtacaattgaaa
ccagtgagaagaatagaaaaacctgaagaatcaaaacccgaagaagtcgtactaaaacct
gcaaagaaacttcccaaagaagaagagacgaaagaggaaataactttaaaatcattcaaa
agagacaaaccggaggagaaatctgaagaggtattattgagaccagtgaaaagaatagag
aaacctgaagaaccaaaatctgaagaagtcgtattagaatctgtaaaaaagctacctata
caggaagaagaaacagttatctcaaaaccaatagaagaggcaaaatccaaagaaataaaa
ttagaatcagtttcaacagtaacagacagaatagaggataaatttgaagaaaaatcgaca
gatgtaacaactccatggcgacgtagtaaacgaacaaaaaaagtcgttgattttagagaa
gaagttacagtagtacccattgatcaagaagaatccgttacagggattcgtgatgaaaaa
gagacaatcataatttcttccgaagatactcaggatttaactaaaagtaaattgaaactt
atatcattacctcataaagaagatagaatgatggaggagatggttgcatcaaaagaaatt
tcatggagaaagaagaaacatgaatctgttaaaataaaagaagaaaaagaaacagttgta
ttaaggcctgttgaaaaattatctgaggatattgaaataaagcaagtggataaagaagaa
agatcagaagaaatattcagggacgatgaagtaactgaattaaaacccatacaatttgcg
gaacaaatagctgacattttggaagagaaacatgaagatgttattaagtcgattaagaca
aaatctaaaattaaagaaattatacccaaagaagttattactactattgatgaaaaagaa
aatgtaggagatgtcaagttacacggtaaaatagatatgacacaaatggaagactataaa
agaaaacgcaaacaacaaactcaagttgacatatcaattatagacaaggacaaaactatt
gctcctagatttattcaaaagttacaacctgttattgctgaattgaagaatcctgctaaa
tttacatgtactgttataggaaacccatttcctgaaatttcttggtataaaaatgagcaa
gaactacatgcgagcgaaagatatactatgactatatttgagacaacagcaacattagaa
attacgaaagtcaaagaagaagatgctggaatgtattcttgtagagcatccaatccagct
ggcgttgcaacatccactgtcaatcttgtgatattcgaaaaagaagaagaaggcatagca
ccacatttctcaactccaatcaaaccactaatgatcgaagaacatacacctgccttattg
gaatgtgttgtaaccggtgtaccagttcctgaagtgaaatggtatcgtggcgagaaagaa
attaaaccaaatgaaagaatcaagatgacttttaatccaacaactggagaagctaagcta
aaaatattagaacctgtacctgaagacgaaacaatttatcgtgttcgtgctgtaaataaa
tatggccgcgctgaatgcaggactaatttggtgatcagtaacattgttaaagtgagcaaa
ccagctgttctcagagcaccgcgaattacacgacctttacttgctctgatagctgagcat
ggaaaacctctaaaacttctagctgattttgagggtataccgaagccagaagtcaagtgg
ttccgtaacggcattgaaattacaccgactgacaaatacaagataaatatttacgataat
acagctgaattaaatataaatgaggtagcaaaaaaggatacaggtaaatatgaaataaga
gttcagaataaagctggcgaagcaagaagctcgagttccgttaccattaaagaacgaaaa
gatactacaagtgaagtgaaagcaccaatgtttacgaaatcgattcagccccaacttgtt
gcagaaggagaagttgtcatcatggaaacaggagtggaatcatatccggcagcatccttt
caatggttccacgaaagcaaacctcttgagtcaacaccgcaggtaagaatcgtaactcaa
gagaatcgatcaattttgatggtaaaagaagttacaccggaacttgctggtagttacacc
tgtcgtgctgaaaacgtcggtggctcggttacttgtacggccaccgttaatttgacagaa
acagcatgggaagaggcaatagaattaatttcaccaacattcgttaaaagactgtcaccc
gtaagagttatggacggagagagtgttaacttaacttgtgttgttgaaggaaaaccaacg
cctagagtagattggtatcacaataataaatcaattaaagaaggcaaagaaattgtaatt
gttcaggacatagagggtatttgtagcttatctattagcgaagtatttccagaggatgct
ggagaatatacttgtcgtgctattaatcctattggtgaggctgtttgtacatcatcactc
gttgttgaagcatacgagtacgtacctgactcggaaattgcatcttcggtaatcgcgaca
tcccttactacgggacaaagcgaatctgaagaagatcttttatctccgaaagaaattcct
atcttcgacactgatatagaagaatctgcaccagagataatcaaaaaacttcctcagtta
gttcctatcaaagatggggaattaactagattggaagtaaaaatgaaaggcaaaccaaaa
ccgaaaggaaaatggtataaacagggcgtagaaattgtctcatcacaagaattccaaatc
gaggaatttgaagacggtacatcagtattgacgatcgctgaaaccttccccgatgacact
ggcgaaattatattcgaagctcataatccactcggtgtatcaaccacgacggcgtattta
tcagtagaaggtatactcggaacaaaagagtaccgaaaaccagaatgggttacacaaatg
gaagaaatgcaagaggctttaaaaggtaagattggtttcatcctgtatgtatgtataata
tttgccatttatattttcagaaaaattgttgatattgaagagactcaatttctggaaact
acagagttcatagaagataaatctgaagagatatctagagcacgaagaataataccaatt
caagagccaatcataactgaagcaacaacttccttgaagaaaattgatgaccaaaaatcg
cgagagcatttacctaaagtcgaaaaacgtgccaaacgaattgtcgaagagcaagaaagt
attatcgtatcagaaattacaagtgaagatactgctcctgatttcaccatcgaaacaaaa
ctcgatagcgctcaaattacttcggaaactctgcaaaaagtttcagtcacagaagcacat
gtagaaagtagtgtgttagaaacgaaacatacagaagtgaaacagaaaaaagcgaagaaa
ataaaagcagaaaagatagaagaagatattactgtaaaagagattgtacagcaacaaaaa
gaaaatatagctcgggaagtcgatgagataatggaaatgcttgatgcaaaagaatttggt
ccgggtgaatttcccttgcgagaactcgcgataataggctatttggttcgacaaggtgtt
tctgtaaacgaaatcaatcaatgtctttataggactgaaatctttcctgctctaaaaaca
cctgatgctcaaaacgctttagttcaattggtagaaagaaaaggccatggtcctttaatt
actcaagtacttaccgaagagacaacaaccgatgagagttttgttgcagcaacagttggt
tttcgtgcttttatgaggatggtcgaacttcagcacgcaacggtggaagaaatcatcaca
cattttgctccggacgatttcaaaccgcgtgcttgggaagttacagaaatttccgaggtc
gaaactgagcagcatgctatggacagtgtagatgtcgttcataaaacggaagtttatttt
atggagaaaagagatgaaaggaaagctactcaggatattcgcgaaattaaagaatacgag
gacacacggcaggcacacacaacattgcgcaaacgcaaagatagaaaaccaaaggatcaa
attgaagaaacaacacaagatagggaagagggggttcaaattgtaaaaatcgaggaagtc
gaagagattgaaaaagaaagaaaaaaagaagaaatcgaagaagaaattattgaactcgaa
cgggactcaaagggcagattgatttataagcaaaaanngcaagatatacaagaacaggta
gatgtagaggaagaggaagatacaattgaaaatgttagaaaaacattaacgccaaaaagg
ccaaatatcggtcaagatgaaatacaactggaagaaatagaagaatttgaaataataaag
gaaccattattgccatctatcgctttaaatgtatctagtcaacgtaaccaaataataccc
ttagatcatataatcgagcaagcgcctggaaaacccgaatcgacaaaagctaagtataca
ttggacactgttctcgcgctaacagaacagacgatgtcagtacatgaaaaagaaatcgat
caagtaacgatcattaagcctatcgaacgtaaagcatcgatatcaatctcatcgatagaa
ccatattctaccgtagaaacaacagcacatatatctactgatgaattctcagatactttc
aaagccgcttcttttgaagctacctctatgataataacaaaagaaagtcttcttatcagc
gaaactatgactcatgatgataacatatcaagtctaactttgatcacaccggaaatgagt
cgaaatgcaaatgtgcaggttactgtacaggaagccacatctgttagagagactatagtt
aatcaaagtgaaatacctaccgaagattttataacaccgttaagtgttacggcggaagat
atcgttttaccacaaatatcactttcggtttatgagatacaagaaggtttggctgaagat
aaattggaatctgcaaaaacgatgtttacgaaacctcgaattaatgtcaatgcaatagaa
ccattaatggtggaagaaatacattccgaggataaaccaggaaaatattatccggaatta
atagtacctactgaagttgccaccgaaacgataatctcgcaaaaacaacgtataactgaa
gaaatgaatgcacccgaaaaagaaggaacatacattccaggtaaattaccaccaagtcaa
atggctcaaatcggaatcacctatggaaacgaaacagctgttattcgtcacgattttgtt
caggagcgcgaaggtgaatatattcctgatcataaaatagattctttcgaagcgacaccg
aatatcactgttttagaaggagtcacaatttcaacaattgatactcaacaaaaggaagat
gatttaacaatcgaacaaagcaaacatattacggctgacttaaatgttgtcgaaattata
tcagccgtgacaatagagacaatgacttctgaaaaagaacaagactatcataatgaagaa
aagcccaccactaaatcagccattacgtcaatttcttcattagagattggttctataaca
gatacaattgttcaagaatccgaaggaagttacagtgttgatcaaaaaccatgcggagta
ttggcggaaacgtcagtccgaccagaggaacatatcttgatatctcaaattcaaactgca
gactatcccgcagacttaaaagacacgctcaagtatatttcagagagcggtactatatcc
gttcaattgacagaagcgaaaactattctcgaaacgcttgctcatgatcaagagactact
atgaaggaagatgttacaccagaaactcatacgatcgaaacaatctacgacgttgttaga
ggtattgagatatcgcaaactacttccatagaaaaagaagccgatttaaaaatatttgag
atgcctgaatcacatcgcggcaaaacagtgcctactcatccaatgatttcacttgaagtt
caagaaactcaaccagaaaataatttaggtgaagtaataaaagatgccttatcaatagct
acagctaaaattggagcaatcggtctacaagagatgattgttggtgagactattgtggcg
gaagatgtagctccggcgaggaaggataagggtcccgagactacgaccgccgtaatctca
atgaatcaaatcgagagcttgcatactacgatggtcatagcaggtgaaaaagaatccgaa
tacattgaagcgactgatgttaaagatgcatttgcaaatactgaatatatgacgcaagtg
gttccaatatgcgaacaagtaagaacagaatcgcctaccgaagaatatctagcggtagac
aaacctataagtggaaaagcatatacatctcacattcctatagagactattagcgttgct
atgcaagaaaccgcggaaaaggaagaaatttataaagcggatacaaaacctgaaggaagg
atagcaaatattgaactcacggaaatgaaacctggtgccagcgttttagaaataattcca
catgatcttgagaatatttatacaccagatactggtccacagacccatatggttgaatca
tccataactggtcatactatcgcgtcaaaagcagaagtcatagtggaacaaagtgctgga
aaaataagcagcgatattccgaaatcaggcaaagcaataatacaacaagaagctctagaa
gaattaataataacagaaacaaatgtcagtgaagcagaacgagttagagaggaagatacg
cgtcctattcaacaaaatgccgcagtcgaagtatgcgctcgatctgaaaaattaactgtc
actgaagtaacaactatattaaaggaagaagaattgccaatggataaattaccaaatgaa
cgaagagttatattagatataaccgaaggccgtgagatagccgaaacgcaagaaatgatt
cttgcaaacaatataagtgaattaaaagaagaaaaaccaaatcaagaaagtgccaaccag
ttgcaaaacggactagatgttgtacaacagatggaagtatcgatatctgagaaagaatct
cctttaaagatggatgtgaaacctgatgttaaaaatattggtattagtttccaagaggga
gaaagtctgacaattgaaattacacatcccgaagacaaagaagatgtgcttgatgaaaaa
caggtgccgaaaacagccgaagctacaatcaatgtaataacacacaatatagcgtcgaaa
tttgagattgttagtaatgtcaccccaattgaattatctaccgaatttactcaagaagca
cgtcctaaagcaacattattaccatttgaaacagctattgctgaagaagtacagacaaga
gaaactgaaaaggctttctttcatatgccagcgccagagaaaagagctaatcttgaattt
ataataggcgaagggcttgttgtatcttctgtgacagcaagtgacaaggaaagcatattc
gcagaaatagaaaaaccgcaattaaagtctgctagttttgatattcccgcacatattgtg
gcagaagctgtcgaagtaactgcgaccgataacataagagaattaatacatgaagaaaca
atctccgcgatggctacgactgagcatatcactcattctagtattgttacatccgatatg
tcagttggtgattcagaacaacctatgctcgactttattacaccagataagaaaagagtc
gatgtatcgttcgaagaagaaacgagtgtaacagtaattgaaacaattgcatctgacaag
gaacgagaatatttgaagaaactgaatattcccagcgaacaaattaccaccagctttgac
gctcataaaatcgccgagctcaccgagattacaccggctatttatccaggagatttggat
gtgaaagcgccaatgagtgcagcagcgaaagaggaacgtttaccgtttgaaagcattgtt
caaagtgaaactgttgcaacagaaacagaaatagaatttaaagataaaccaactaaaacc
gatacggcccatatatctgttgatgagattatcagtgccactatgttcactgaaattcca
ggcgaaaaagaagatatccttcgaattcccaaaaaacctatagagaaaaaagccgaggtt
cagtttaccggacatgttattgctgaaaaaagcgaagtcaatcccgcttctagtgctgga
atactgatggaaacgaaaccgacttctattacagctatactttcaagtattccgttagag
gcagtagtacaaacagaaacacagccaacggaagcggaggctacactcgggaaagataaa
ataccatctatgactgaagctgatctttcaatgatagtggaacaaagtatagaaatatct
tcagtaatcttggaggataaagaaaccgaatatagaccgaaggaaacaccaaaaccaaga
acagcggagaaagcgctaattgagactcatggcgtggccgaaacaataatgcagattcct
gattttagtaccggcgaaattgcaactggcgaaataccattggctgctgttgcaattcca
gatcatatagtttttaatccgttagtagaatcacagcctgttattcaagaaaaagaaaaa
gaatttgttccaacattaatgccagaaaataaaactataaatattgatatgcaagaaggc
aaagcaattgtaagtatagcacatgtaacacctatagataaagaatcaccgtatgtcatc
gaagaacaaccgcgtaaacatgctgcttcattcaatatcaatgccactcacggtatagca
gaaacaaccgcggtagctgttgaacattctataggaaaagtaactattgaaaaaccagat
attaaaacagtatcgtctacgcacgaagtgcatcaaagtctcttagtgaccgaaggcata
tctcaagaccgagagaaacctttcgaagataaattcatgcctgaaatgcacaaaacagaa
ttatccgttgaggagggtaagcgcgttacttctgttacagaaattaaaatagctgataaa
gaagctccccttaaaatggtattggaagatagaactcatttggcactctcggttattact
cctggtcatgaagtagccgaaagatctgaaataattctcaattcaagtacaggtgaaata
aacgaagttatagcaccaacaaaaataacagcgctaattaatcaaaaaccttttgaaaca
gtgcaattaaccgaacaaattcccatagagaaagaagtggacagcattcgggaaacacca
ctgacaaaaacaagtgcacgtgttgttttagatgaaaatagatttgtcgctattacagaa
tctattactgctcaagatgtagaagaagaatttgctacaaagaaacttcgtcaagaggca
gcgaatcttttaatggagggcaaagaagtagccgaacgaacggagattaatttacgcgaa
ggactcggagaattacctgtgacatcagaacctattatatgcgaagcacatagaattcag
tctactttggaaagtattgatgtgatcgaaacgatttctcaggagcaaggtacagcattc
tttgataaattcaaacctaatacatgtaacgttgacatcaggtttgtcgaaggaaaaagt
attactgtagatcacgttgtagcacaggacaaggaaaaaacgataaatattccgagatat
gaagagagtacggctaggataaaactaacaaaagctggtatggatgttgcacaaaaggct
caaatatttgtcgagcaaaatattggttccgttaaacctttagaaaaaatacaagcagaa
gctcatataaagcaagatgagtttcaatctatcattattcaagaagttccaagtgcagaa
agcgaagatacttttaataagtatccaaaattgatattgagcacagctgtgccaaaattt
gaggaaggtcatagtgtgtttattacggaggtaacatctggtgaagtcgaagaatcattc
gaagagaagaaacataaaacgtcacaaatagccatccgttctattgtaaccgaacgcgat
tcaatagagactacaatggtggaatcacgagtcaatgtacctgaacaacttcctgatcgt
acttcagtaccacaagtagccacgccggcccaagacatgtttgaaagcattattatcaac
gaaaatcttatcgaggaaagcgaaaagacttttgatagtctttttaaaccaatgacacaa
aaagcaaatatcaatataacggaaataaaaccgttacaaatttcagaaacaattatcgaa
gataaggaaaaagtattggatattgcgacaaaacattctgaagtcaaagctacgccaggc
attgatctgtttcaaactatcgaaggttcttttgtagaaagcatacaaagcactcaagag
ctctatgaagacaaaccactttcttctcaagcaactataagtcaaaccacgatggagacg
atagtaaacgttgaaactacgacggctgaaaaggaggatatttttaagagcacttttcaa
cctgaaaaacaaaaaggcaatccacagttcgaaggtcttacgacagttgtaattactgag
atagcttctaatgagattgagaatatcttacctgaagttgttccaccgaaacagcatcag
gcgcaaccaaatttaacgagtaaagaagccgcggaaattcttcaaatagttactgcaaac
acaacccaagatcttgcggaaactactaaattatacgaacaaagaggtaaatcagaattt
gaagaattatcatcactaaccatttccgaaatagtttcaaatgaagttgaagacgtctta
atcagtaaaattactccaaaagattgcaaggctgacttcaatgtttctggtagagaagcc
gccgagacaattcaagtaacaacaatatccgaaaccaatgagcttgctataaaaggacct
gaagaacagaaaagtagccaacaaatcaatgaactaattccattgactatttcacaagtt
atttctaatgaaaccgaagaaacattaattagcactgaatttcctaagaggaaaatagca
caaccaaatttatttggtagagatatcgcggaaacaacactagtcttaacaatgactagc
gctgaagaatttattcctaaaaaagaaaccgaaaaacaaaaaggtaaacccactctcgaa
gaattaacgcctttaatgatttcacaaatagaatctcaggaaatcgaaagtgttctcgcc
agtcccaaaattccaatcaagagaatggcgcagacaagtttgtatggaagagatatagcg
gaaactatggaaataacgactgtattaaatgtagataaatttgttgaacttcaaaagcct
gaagtacaaaaaggaaaaccgaatctcgaagaattattacctttgaatgtaatgcaaacc
gtatctaatgaaacggaaacttttctgcttagtccagatattcctgtggaaaaaatagca
caagctaatttatccggtagagatatagccgaaacaagccaaattttaacgatgataagt
acagaagaactctcacaacaaatagcaccgaatgagcgtaaaggagaattcaaggtagaa
gaattatcctctttgactatatctcaggtattgtctcatgaaactgaagaaacttttcag
agtcctgatgtacctagtctacttacggcaatgcctacgatgtctggtagagaaattgct
gaaacttctcaagtactcaccgttacaaataccgaagaattttcgagacccaaaagtcca
ataggacaagaaggtaaaccacgtgtggacgagttttcaccactcacggtttctcaaata
atatctattgaaacagaagaacaattgccgaatttagaaagattagacgagaaaatagca
aaaccatgcctttctggtagagaaatagcacaaaaaattgaaattgtaaccgcctcaact
gtcaaacaaatacctgaagtaaagaaaaaagaagatcagaaaggaaagttagatatcgaa
gaaatgaattttattattatgtctgaagtaatttctacagagaaagaacaagaattaccg
agttaccaagagattccaaaagaaggtaaagctctgcctaaaatattaagtagagaagta
gcagaaatattagaaatcttgccagtaagcaccgtcaaagaacttgcaaaaatgcaaata
tctgaacaacagaaaggaaagccaaatttagaagaattgatgccattattgatatttgaa
gtaccttacaatgaagcggagaaagaactacccacactaaatgaaccaactaggcaagta
gctgaagaaagtatgttgagcatgcgcgttgccgaaaaatcacaaacaattccatcgtta
acaacggatgagatgatagagactgccaaacctctaataaagaagataacaccgaaacaa
ataccatacgaaagtatacaacaaactgaatcaattcctcatgaaaaagaacgcctactt
gtttctgataaacaaacatcaagtgcaacagccgatatttcatttcgaatttccgaaggc
attgaagttatccaagtaactactacagaaaaggaagtaaaagaaatcgtaaaaagccta
gaagggactcatcagactgccgagcagagtatgttaagtatgcccgtagctcaaaaatct
caagtgattatatcatcaacaactgatgagattatagaatctgcaaaacctgaanataag
aaaataatgccagaacgagtaccatttgacagtatacagcaaactgaatcgattcctcat
gaaaaagaatgtttgctcgtttctgataagcacacaccaagtgcaacggctgacatttca
ttccgtgtttccgaaggtgttgaagttatacaagtaaccgctacggaaaaggaagcacaa
gaagttgcaaagagagtgaaagaaacaactaaacagactgccgagcagcgcatgttgagt
atgcccgtagctcaaaaatcccaagtagtaacatcattaacaactgacgaaattatagaa
tccataaaacctgaaatgaaacaaataattccggaacaagtaccatttgaaagtatacaa
cagatcgagtcaataattcatgaaagtgaatgctcacttatctcagataaaagaagaaca
ccaagtacaatagccgatgtttcattccgcacttctgaaggtgttgaagttatccaagta
actactacagagaaggaaatgaaagaaattaaagaattggaagaaacacctaatcaaaaa
gctcagcaaagcatgctaagtatgtctgtagctcaaaaatctcaagtatttccaacatta
acaacagaagaaattacagaatctgcaaaacctgaaataaagaaaataatacctgaacaa
attccatttgaaggtatacaacaaatcgaagcaatccttcacgaaagcgaaggttcatta
agcccagataaaaaaactccaagtacaacagccgaagtttcattcggcgtttccgaaagc
gttcaagttattcaagtaactgctaccgaaaaggaaacaaaagatgtgataaaaaatctg
gaagaagcaactcaacaaacagccgagcaaagcatgctaagtatgtccgtagctcaaaaa
tctcaagtatttccgacattagcaacagaagaanttatagaatctgtaaaacctgaaata
aagaaaataatacctgaacaaataccatttgaaagtatacaacagattgaatcaattctt
catgaaagtgaacgttcgttgcatcctgataaaaagagaccagatgcaacagccgaagtt
tcatttcacgtttccgaaggcgttgaggttatccacgtaactgctgcagaaaaagaaaca
aaagaagcagtaaaaatattggaaggagtaattaaacaaacagccgaacaaagcatgctg
agtatgccggtggctgagaaaactcaaatggttacatcatcaacaacacaggaaattata
gaatttcctaaacctgaattaaagacaataataccggaacaaataccatttgaaggtata
caacaaatagagtcaatttctcatgaaagtgaacgttcatttactcccgataaaaaaatg
tcaagtacaacggccgacgttacattttgcatttccgaaggcattgaagttactcaagta
atcagtacggaaaaagaaacaaaagaaactgtaaaaagtttgggagaagcaactaaacag
actgccgaacaaagcatactgagtatgcccgtagcacaaaaatcacaaataattgcgtca
tcgacaattgaagaaattttagagtcaataaaacctgaggtaaaaaaaataatacctgaa
caaataccatttgacagtatacaacaaattgaatcgattcctcatgaaaaagaacgtctg
ctcgtttctgataagaaaacaccaagtgcaatagccgatgttgcatttcgtacttccgaa
ggcatcgaagttatacaagtaaccgctacggagaaggaacaaaaaatgtcataa

DBGET integrated database retrieval system