KEGG   Pogonomyrmex barbatus (red harvester ant): 105425583Help
Entry
105425583         CDS       T04903                                 

Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
pbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    105425583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 105425583
NCBI-ProteinID: XP_011634726
Position
Unknown
AA seq 571 aa AA seqDB search
MIIPHVFALLTALIGIEARAYNDAYNDFFDEELMLKPLPNNHIYAYFQFTTIWETANHIE
ALHHTHLFPRGLGEIIGRHNVDELHVTLTEGLWNYQKWGYPFHDAGPGAEIIAWFKRDIT
NVDEEWKGLTNALAGLLCASLNFVDASNSMSPEFTFRPTGVTDGPVNSSHLRYSSLPREI
VCTENLTPFKKLLPCDSKRGLATLLNSAHIHNTNYHSIGIHFRSICRDITCTKPSLELQQ
TVSLIYDTVIDINQDWSIRKFFGMGLKGACPLAILSNIYIDISDNNTNHVYELTPPPNAK
VVSLRGGQQSEIAIYDIRAHSSRGIFNIAAVHSAPKNSIINYPSILYANRYIIGYGQERG
SLVTKLYNNHWQALDVILLENIPWYLLVYLHSITITQNEKQVRPLAQRYLPGRERKSPYY
LELILRLPPHSVTKISIDMDYLFLKWQEYPPDANHGFYMGPAIITALLPIARNYTALPLD
GSTITSSFNASRDGYLVQLRTESLLISLPTPDFSMPYNVICLACTAVALAFGPLHNISTK
RLVLKRIEKDWKGKLVSFFIGKLFGTKKKQE
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgataatcccgcacgtatttgcactacttaccgctttgattggcattgaggcacgtgca
tacaatgatgcatataacgacttctttgatgaagaattaatgttgaagcctttgccgaat
aatcacatttatgcctattttcaatttactacaatatgggagacggcaaatcacatagaa
gcacttcatcatacacatctctttccaaggggattgggtgagatcattggtcgccataat
gttgacgagctacatgttactttaacggaaggtttgtggaattatcaaaaatggggatat
cctttccatgatgctgggcctggtgccgaaatcattgcttggttcaaaagggatataaca
aacgtagacgaggagtggaaagggctgacaaatgctttagctggattactttgcgcatct
ctgaattttgttgatgcatccaacagtatgtcaccagaatttacctttcgtcctactggt
gttacggatggaccagtgaattctagtcatctgcgttattcatcattaccgagagagata
gtttgtactgaaaatctaacaccattcaaaaaattattgccttgtgattccaagagaggt
ctagccacattgttaaattcggcacatattcataatacaaattatcattccattggaata
catttccgatcaatatgtcgcgatataacttgtacaaagccatctttagaactacaacaa
actgtttccttaatatatgatacagtaatagatataaatcaggattggtcgatacgaaaa
ttttttggaatggggcttaaaggtgcatgtccgcttgcaatattaagtaacatttatatt
gacatatctgacaacaatacaaatcatgtatacgaactaacaccaccaccaaatgcaaaa
gttgttagtttgcgtggtggacaacagagtgaaatagcaatatatgatatcagggctcat
tccagtagaggaatatttaatattgctgctgtacatagtgcgccaaagaatagtattata
aattatccctcaattctctatgcgaatagatatattattggatatggccaagaaagaggc
agtttagtgactaaattgtataacaatcactggcaggcgttagatgtaatcttattagaa
aatattccatggtacttgctagtttatttacattctattacaataactcagaatgagaaa
caagttcgtccattggcgcaacgttatttacctggaagggagagaaaaagcccgtactat
ttggaattaatcctgcgcttgccaccgcattcagtaacgaaaatctccatcgatatggat
tatttatttctcaaatggcaagaatatccgccggatgctaatcacggtttttatatggga
ccagccataattacagctttgttacccatagctagaaattacactgctctgccactcgat
ggaagtacaattacttcaagttttaatgcttcgagggatggttatctagtacaattacgg
acagagtccttgcttatcagtcttccgactcccgattttagtatgccttataatgttata
tgccttgcctgtacagctgtcgcattagcattcggtccacttcacaacatttccacgaag
cgattagttttaaaacgcattgaaaaggattggaaaggtaaattagtttcctttttcata
ggaaaattatttggaacaaagaaaaaacaagaataa

DBGET integrated database retrieval system