KEGG   Pogonomyrmex barbatus (red harvester ant): 105426660Help
Entry
105426660         CDS       T04903                                 

Definition
(RefSeq) flavin reductase (NADPH)
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00740  Riboflavin metabolism
pbar00860  Porphyrin and chlorophyll metabolism
pbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    105426660
   00860 Porphyrin and chlorophyll metabolism
    105426660
Enzymes [BR:pbar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     105426660
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     105426660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD Lipase_GDSL_2
Motif
Other DBs
NCBI-GeneID: 105426660
NCBI-ProteinID: XP_011636278
Position
Unknown
AA seq 202 aa AA seqDB search
MGKRVVIFGATGNTGLCSLRAAVENGLDVRAYVRDKAKIPDDIKNKVESVVGDVINAKQV
ADAVADRDAVVVALGTRNDLNPTTVLSQGLKNIIDAMKAHNVERISVCLSAFLFYKPEAV
PAIFKDLNADHQRMFDMIKMSGLKWVAILPPHIADTPKSKYTITFDSSPGRAISKHDLGA
FLVECLDNPDYYQKVCGIATTS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagcgagttgtgatattcggagcaacggggaacacgggtctctgctccttgaga
gctgctgtggaaaatggtctggatgtaagagcttacgtgagagataaggccaaaattcct
gatgatattaaaaataaagttgaatcagtcgttggagatgttatcaatgcaaaacaggtt
gcagatgcagtagctgatagagatgctgtcgtggtagcacttggaactagaaatgacttg
aacccaactacggtgctatctcaaggtttgaaaaatataatagacgccatgaaagcacat
aatgttgagcggatctctgtatgtctatctgcgtttttattctacaaacctgaagcagtg
cctgctatattcaaggacttgaatgcagatcatcagcgcatgtttgatatgatcaaaatg
agtggcttaaagtgggtagcaatattgcctccacacattgcagacacaccaaagtccaag
tacactattacgttcgattcttcacctggacgggcaatctccaaacacgatttgggagcg
ttccttgtcgaatgtctcgataatcccgattattaccaaaaagtttgcggcattgcgacc
acatcatga

DBGET integrated database retrieval system