KEGG   Pogonomyrmex barbatus (red harvester ant): 105426743Help
Entry
105426743         CDS       T04903                                 

Definition
(RefSeq) plancitoxin-1
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105426743
Enzymes [BR:pbar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     105426743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 105426743
NCBI-ProteinID: XP_011636423
Position
Unknown
AA seq 381 aa AA seqDB search
MFSLLCISILLFACDAKSAANPRCRDENNRIVDWYVLYKLPKTSQSSNPVVREGLAYLYM
TNNTVDKGWQLSRKNISAKNSIPGNTLAPLYNDSQASKAFWFLYNDDAPNRGVNGKYGHT
KGVMMINKQEGFWLIHSVPQYPPVPNSGNDTRRGHRMESYPGATYNYPSSGENYGQSFLC
ISVDSDQFDLIGRQMMYNQIIVYRRNIPATFIATFPVLTKAANQKRIRQAPFNSKALFKS
SNGVEFTSFAKSDKWQKDLYDDFVAPTLQTDLFTETWLNGRGRLPSDCEQVNVYNIISIY
IHLDEIDIDFKSSRDHSKWAVAVQGKGNRTWICIGDINRADTQYVRGGGTVCFNNKKVWE
NYRKIVNDVEQCPKHYKTILI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgttattgtgtataagtattttattgttcgcatgtgatgcgaaaagtgcagca
aatcctcgttgtagggatgagaacaatcgaattgttgattggtatgtactttataaattg
ccgaagacatcacaaagcagcaatccggtggttagagaaggattagcgtatttgtacatg
accaataatactgttgataaaggttggcaattatccaggaaaaatatcagcgcgaagaat
tccataccggggaatactttagcacctttgtacaatgattcacaggcatcgaaggctttt
tggttcttgtacaatgacgatgcgcctaatagaggtgtcaacggaaaatacggtcatact
aaaggcgttatgatgattaacaaacaagaaggtttctggttaatacacagtgttccgcaa
tatccacctgtacctaacagcggtaacgatacaagacggggacaccgcatggaatcgtat
ccaggggctacatataattatccgtcatccggagagaattatggacagagtttcctgtgc
atttccgtggatagcgatcagttcgatctgattggtcgacagatgatgtacaatcagata
atagtgtatagaaggaacatccctgctacattcatcgctacgtttccggtgctcacgaag
gcagctaatcaaaagcgtattagacaagcacccttcaatagtaaggcattgttcaaatcg
tccaacggtgttgaattcacatcctttgccaagagtgacaagtggcagaaagatttatac
gacgattttgttgcgccaacgttacaaactgatttatttactgaaacatggttgaatgga
cgaggtagattgccatcggattgcgaacaagtaaatgtatacaatatcatatctatttat
atccatttggacgagattgacatcgattttaagagtagtcgtgatcactccaagtgggcg
gtggctgttcaaggtaaaggtaatcgtacttggatctgtattggtgatattaaccgagcg
gatactcaatacgtgcgaggcggtggaactgtttgtttcaataacaagaaagtttgggaa
aattatcggaaaatagtgaatgatgtagaacaatgtcctaagcactataaaacaatttta
atttag

DBGET integrated database retrieval system