KEGG   Pogonomyrmex barbatus (red harvester ant): 105428043Help
Entry
105428043         CDS       T04903                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pbar04131]
    105428043
Membrane trafficking [BR:pbar04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    105428043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N AAA_25
Motif
Other DBs
NCBI-GeneID: 105428043
NCBI-ProteinID: XP_011638397
Position
Unknown
AA seq 1995 aa AA seqDB search
MSSVQRAFAHKLSKQHAADVRRQIATSTSYSRDLSKSGSSVSGFSSTMSLCEVLEPLDYE
EFLGQHQTVLDRDPLKPILDFPPGDVELRVVKRKIRTEEPVVPHESIDTVSPYVKRCIES
FTSDWIIIHRKYKGRISPIARDRLLQDTPRQDFEVDQEDANGCVSPNEEDDLSNSGDTPR
GSWASLDLRHSQHDPLLPSLLDRVCLETIDQMNEQKRLEDRQEALFPLYAPPTSPDDEWQ
EISVALEPTEPFAHKILVKCLQLKLELEVEPIFASLALYDAKERKKVSENFYVDMNSEGL
KRMLGGHIAYSDASTLARSCVLSISKPSPDLFLVVRLEKVLQGDISECAEPYLREDKNKD
KVRAAAAAACERLGRYRMPLAWTAIHLSGVIGGGGDTDSTGSAGSLDRKSGGLEQWRKKV
EPPTRRGSLERRSSDKRRSWSPDDFANCLDSFRPITLTVSSFFKQESERLRDEDLYKLLV
ELRRPGSNLKRLKCLPGILKLDLSPRPEELPRCLDPDLRRLVPYPDEKSRPVKEILEFPS
EVVSPDLTYRNLLYLYPKEANFSSRTGSARNIAVRIQLMGGEQEADALTAIFGRSSCPEM
THEYFTSVSYHNKNPNFYDEIKMRLPADLSAKHHLLFTFYHISCQKKAEQPNVETAVAYT
WLPLLRDGHLQSGEFSLPAMLDPPPANYSYIAPDVLLPGTRWVDAHRGVFTVILEPVSSV
HPQDKYIDRFLSLCGFLETGQVPPRIGEAGMESELKSALLELARASHSALVRSLPQLLDQ
LLCLLVRPPTLPSQSLNVAATIFEAIGLLVRNITNLPDGQLDAHGRHALLATYIAYQCSL
PSMTHSGGVARAQSNPDLPLEDLEMEIHSRGLDRTASMRQESPSINSHSTRRLLHEELAL
HWVVSTGQARELAITHSWFFLELIMRSMVVTLSEMGSLEAPRKLRFSPQFCDDVATLTAA
LTSEVISRCSKEIRVASNLISSLGNFLSDLLSVMDRGFVLSLVRAACCSLSDASMHIPDS
AALFALKLDLVRTVCSHEHYVALNLPFGTGYTSGSAPASPSPSTGSSGSLISTLVPGDRT
RFSELSQEFRQQHFLVGIVLSDLANTLEIPNPMLQNKAIGTVRHLMSCHDADTRYTDPAA
KARVAALYLPLLSILMDALPQLYHWDSKDKSVYPDESGSITQSVALAIAGGASADTAGNQ
CRVSLSSEATRHLLMCALWVLKGLERTALAQWCSELSARRILSLLQVLNIATAAFEYKGK
KALKRLPPQATVTSDIRSRLEDVILGQGSARSEMMLRRKERVTGDKLRWRKDQMPYRSCE
QPEGRAVEQDAHIEGALAAEASLVVLDTLESVVQADGGGGAVVGAVLKVLLRALARNQST
SVLQHMFNTQRALVFKYHSALFDEESERCGDLCLTLLTRCSSPLSAIRSHAAASLYLLMR
QNFEIGNNFARVKMQVTTSLSALVGRGRAPSEGALRRALKTVLVYAERDTELADTSFPEQ
VKDLLFNLHMILSDTVKMKEFQEDPEMLLDLMYRIAKGYQGSPDLRLTWLANMAQQHMER
KNHTEAAMCLVHSAALVAEYLHLLEPGGGGRPVGAVALNAVTPNALEESAVGDDVLARRE
EGLCLGPDFSESGLAGLLEHAASSFHAAGMYEAIPDVYRVLLPIAEAAHDYKKLANIHGK
LHEAYTRVEQLAGKRVFGTYFRVGFYGARFGDLAGEEFVYKEPTLTKLPEIFSRLENFYA
ERFGADNIVIIKDSNPVDPSKLEPDKAYVQITYVEPYFEAHELRHRPTVFHRNFNIKRFV
YATPFTPGGKAHGELREQCKRKTILTVATHFPYLKTRIRVVARKQIVLSPIEVAIEDIQK
KTAEVAAATAQEPPDAKMLQMVLQGCIGTTVNQGPAEVAVVFLSGLREQNAQPTRLQHKL
RLCFKDFQKKCLDALRRNKNLIGPDQRDYQRELERNYQRLTERLAPLIAWSGPSLINQQA
VPTTPPRWRGNETLP
NT seq 5988 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcggtccagcgtgcatttgctcacaaattaagcaaacagcatgctgccgatgtg
aggcggcaaattgctacttctacgtcctattctcgtgatttatcaaagagtggtagcagt
gtgtcaggattttcctccacaatgtccttatgtgaagtattagaaccacttgattatgaa
gaattcttaggacaacatcagacagtattggatcgtgatcctttaaaaccaatactagat
tttccaccaggggatgtcgaattgagagtcgtaaagagaaagattcgaacagaagagcca
gtagtaccacatgaatcaatagataccgtatcaccttatgtaaaaagatgtatcgaaagt
tttacttcagactggatcataatacatcgtaaatataaaggaagaatctcacctatcgcc
agggatagattactccaggatacacctagacaagatttcgaggtagatcaagaagatgca
aacggttgtgtatcaccgaatgaggaggatgatttgtccaactctggagatacaccgaga
ggatcttgggcaagtttggacttgcgacattcgcaacatgatcctcttttgccgagttta
ttagatcgcgtctgtcttgaaacgattgatcagatgaatgaacagaaaagattggaagat
cgacaggaagctttatttccactttacgctcccccaacttctcctgatgatgaatggcaa
gaaatcagtgtggctctggaacctacggagccttttgctcataaaattcttgtgaaatgt
ctgcaattaaaattagaactagaagtggagccgatatttgcgagtcttgcattatatgac
gccaaagaaagaaaaaaggtgtcggaaaatttctacgtagatatgaattcagaaggattg
aaaagaatgcttggaggacacattgcttatagcgatgcaagtactttggccagaagctgc
gttctgagtatcagcaaacctagtcccgatttgtttcttgtcgtgcggttagagaaagtg
ttgcaaggtgatatttcagaatgtgctgaaccatatttacgtgaagataaaaataaagat
aaggtcagagctgctgccgctgctgcctgtgaacgcttgggtcgttatagaatgcctctc
gcgtggactgcaattcatttgtctggtgtaattggaggcggcggtgacacagatagtact
ggcagtgctggatctttagacagaaagtcaggcggtctagaacaatggcgaaagaaagtg
gaaccgccaacgcgacgaggttcgctagaaagacggagttcggacaaaagacgtagttgg
tcccccgacgattttgccaattgtctcgatagctttagacccattactttaacagtttcg
agcttctttaagcaggaaagcgaacgactccgtgatgaagatctctataagcttctggtc
gaactacgaagacctggttctaacttgaaacgattaaaatgtttaccaggaatattgaaa
ctggatctcagtcccagacccgaagagctgccgagatgtctcgatcctgatcttagaaga
ttagtaccatatccagatgaaaagagtcgacccgttaaggaaatactcgaatttccaagt
gaagttgtttcaccagatttaacatatcgtaatcttctttatctctatcctaaggaagca
aacttcagttccagaactggttcagcccgcaatatcgctgtaagaattcaacttatggga
ggtgaacaagaagctgacgctctcacagctatctttggcagatcatcgtgccccgaaatg
acacatgaatattttacttccgtgtcatatcacaataagaatccaaatttctatgatgaa
atcaagatgagactccctgcggatttaagtgctaaacatcatttattgttcaccttttat
catattagttgtcagaaaaaagcggaacaaccaaatgttgaaacagctgttgcttataca
tggctaccgcttttaagagatggtcatcttcaatcaggcgaatttagtttgcctgctatg
ttggatccaccacctgcaaattattcttacattgcgcccgatgttctcttgccaggtact
cgatgggtagatgctcatcgaggtgtttttactgtcatattggagcccgtttcaagtgtt
catccacaagacaaatatatcgacagatttctatcgttatgtggctttttggaaactggt
caagttccgcctcgtatcggtgaagctggcatggaatcagaattgaaatcagccctcctc
gaattagcacgtgcctcgcattccgccttagtgcgatcgcttccccaattgctcgatcaa
ttattgtgtcttctagtgcgaccgccaacattaccatctcaatcgttgaacgtcgccgcc
actattttcgaggcaataggactactcgtacgaaatattactaatttaccagatggtcaa
ttagatgcgcacggaagacacgcgcttttggctacctacatcgcgtatcaatgctctttg
ccgagtatgactcacagcgggggcgtcgcgcgagctcaaagcaatcctgatctaccttta
gaagatttagagatggaaatacactcacgaggattggatagaaccgcatctatgcggcag
gaatctccctcgatcaacagtcattctaccagaagacttttacacgaagaactcgctttg
cactgggtcgtatctactggtcaagcacgggaattggcaataacccattcctggttcttt
ttggagttgataatgcgctcgatggtcgttactctatctgaaatgggatccttggaggca
ccgcgaaagttgagattttcgccgcaattctgtgacgatgtcgcaacactcaccgctgcg
ttaacatccgaagtgatatcacgctgcagcaaagaaattcgcgtagcatccaacttgata
tcgagccttggaaactttctgtctgacctattgtccgtgatggatagaggattcgtattg
tcgctcgttcgcgctgcctgctgctcactgtcggatgcgtcgatgcatattcctgactcg
gcggcgttatttgccctaaaactcgatcttgtaagaactgtgtgttcacacgagcattac
gtagcattaaatcttccgtttggcactggctatacctcgggatctgccccggcatcacca
agtccatcgactggcagctcaggaagtctgatatccactcttgtgcccggagatagaacc
cggttttcggagctcagtcaagaattcaggcagcaacatttcctggttggtattgtgcta
tctgatttagcgaacaccttggagataccgaatccgatgttacaaaataaagctatcggg
actgttcgacatcttatgagttgccacgatgctgatactcggtataccgatcctgcggca
aaagctagagtcgctgcattatacctaccattgcttagtattttgatggatgccttacct
cagctttatcactgggattccaaagataaaagtgtttatcctgatgaatccgggtcgatc
acgcaatcagtagcattggctattgccgggggagcatcggcagatactgcaggtaatcaa
tgccgcgtatccttgagctccgaagctactcgacatctgttaatgtgtgccttatgggtg
ctcaagggtttggagcgaaccgctctagcgcagtggtgctccgagcttagtgcaagacgc
attttgagcttattacaagtattgaatatcgctactgcggctttcgagtacaaaggcaag
aaagcgttgaaaagattgccgcctcaagccacagttaccagcgatatcagatcgcgactg
gaagatgtgattctcggtcaaggaagtgccaggagtgagatgatgttgcggcgaaaagag
agagtgactggtgataaattgagatggcgcaaagatcaaatgccttacagatcttgcgag
caaccggaaggaagagctgtggaacaagatgctcatatagaaggagccttagcggcagaa
gcttctcttgtcgttttagatacgttagagtccgtagttcaagctgacggcggtggaggt
gcggttgttggcgccgtattgaaagtgttactaagagcattggccagaaatcaaagtaca
tcggtacttcagcacatgttcaatacacagcgggcactagttttcaagtatcatagtgca
ttgtttgatgaagaaagcgagcgttgcggggatttatgtttgacattattaactcgatgc
agttcacctttaagcgctattagaagtcatgcagctgctagtctgtatttgctaatgcga
cagaacttcgaaattggaaataattttgcacgcgtcaaaatgcaagtcacaacgtcctta
tctgctcttgttgggagaggaagagctcctagtgagggagcattacgtagagccttgaaa
acagtgctggtatatgctgagagagacacagagctcgcagatacgagttttcccgaacaa
gtgaaggatttattattcaatcttcatatgattctttctgatactgttaagatgaaggaa
ttccaagaagatcctgaaatgcttttggatctaatgtatagaatcgccaagggctaccaa
ggatcacccgatcttcgtctcacttggctcgcaaacatggcacagcagcacatggaaaga
aaaaatcatacagaagcagcaatgtgtttggtacatagcgccgctctagtagcagaatat
cttcatctattagaacccggcggtggaggtcggcctgtaggagccgtcgctttgaatgcc
gtgacaccaaatgctttggaagaaagtgctgtcggcgatgatgtattggcaagaagagaa
gaaggactttgcttaggtcctgatttttcagaaagcggattggcgggtttattagagcat
gcggctagttcttttcacgcagctggaatgtatgaagctattcctgacgtctatagagtg
ttactgcctatagcagaagctgcacatgattataagaaattagctaacattcacggtaaa
cttcatgaagcatatacacgtgtagaacagttggcgggtaaacgcgtcttcggaacatac
ttcagagttggtttctacggcgccagatttggtgatcttgccggcgaagaattcgtttac
aaagaaccgactttgacaaaactcccagaaatattttcgagactcgagaacttttatgcc
gagagattcggcgcagataatatagttataataaaggattcgaatcctgtagatcctagc
aagctggaaccggacaaggcctatgtgcagatcacttatgtcgaaccgtattttgaagcg
cacgaacttagacacagacccacagttttccatcggaattttaatataaaacgatttgtt
tatgcgacacctttcactcctggtggtaaggctcatggtgaactgcgcgaacaatgcaaa
cgaaagacgatattgacggtggcgacgcatttcccatatttaaaaactagaattcgagtt
gtagctcgaaaacagattgttttgagccccatcgaagtggcaatcgaagacatacagaag
aagactgccgaggttgccgctgcaaccgctcaggaaccaccggacgctaagatgttacag
atggtccttcaaggttgcatcggcacaactgttaatcaaggacccgctgaagtagcagtc
gtgttcctttccggcttacgtgaacaaaatgcacaacccaccagattgcaacataaactt
cgtttatgtttcaaagattttcagaaaaagtgtctcgatgctttgcggcgtaataagaat
ctcattggtcctgatcagcgagattatcaacgggaactggagagaaattatcaaagattg
accgagagattggcacctctcattgcttggagcggaccgtccttaattaatcagcaagct
gtaccaacaactcctccgcgttggaggggaaatgaaacactgccatag

DBGET integrated database retrieval system