KEGG   Pogonomyrmex barbatus (red harvester ant): 105428157Help
Entry
105428157         CDS       T04903                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase 1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00010  Glycolysis / Gluconeogenesis
pbar00030  Pentose phosphate pathway
pbar00051  Fructose and mannose metabolism
pbar01100  Metabolic pathways
pbar01200  Carbon metabolism
Module
pbar_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105428157
   00030 Pentose phosphate pathway
    105428157
   00051 Fructose and mannose metabolism
    105428157
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbar04147]
    105428157
Enzymes [BR:pbar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     105428157
Exosome [BR:pbar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105428157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 105428157
NCBI-ProteinID: XP_011638579
Position
Unknown
AA seq 338 aa AA seqDB search
MASKNTMDSDCMTLTRFVLAEQRKVPTATGDLTQLLNSIQTAVKAVSSAVRKAGIANMYG
IAGNTNVQGEEVKKLDVLSNEPFINMLTSSFTTCVLVSEENQNAIEVETEKSGKYVVCFD
PLDGSSNIDCLVSVGSIFGIYKKPERSGESTLQAALQPGQNLVAAGYALYGSATMIVLSI
GHGANGFTYDPAIGEFILTERNMRMPDRGNIYSINEGNESTWDSSIKEYIHSKKYPATGK
AYSARYVGSMVADVHRTIKYGGIFLYPASKSNPNGKLRLLYECVPMAFIVKEAGGLATNG
KIGILDIVPENIHQRSPIFLGSKDDVNDVMTFIKNKTD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgaaaaacaccatggactcggattgcatgacgctgacgagattcgtgctggcg
gagcagcgcaaggtgccaacggcgaccggtgatctcacgcagctgttgaacagcatacag
actgccgtgaaagccgtcagctcggccgtgaggaaggccggtatcgctaatatgtacggc
atcgccggcaataccaacgttcagggcgaggaagttaagaagctggacgtcctgagcaac
gagcccttcatcaacatgctgacgtcctccttcaccacgtgcgtgctcgtgagcgaggag
aatcagaacgccatcgaggtggaaacggagaagagcggcaagtacgtcgtgtgcttcgac
ccgctcgacggttcgtccaacatcgactgcctggtctccgtcggctcgatcttcggaatt
tacaaaaaacccgaacgatccggggaatccacgctgcaggccgcgctgcaaccgggacag
aacttggtcgcggccggatacgcgctgtatggctcggcgactatgatagtgctctcgatc
gggcatggcgctaatggattcacgtacgatccggccatcggggaatttatactgaccgag
aggaacatgcgtatgcccgacagaggaaatatctatagtattaatgagggcaacgagagc
acgtgggactcgtctatcaaggagtatatacattccaagaaatatcccgcaaccgggaaa
gcctacagtgccagatacgtaggctccatggtcgccgacgtacaccgaacgattaagtac
ggcggtatctttttgtatcccgcgagcaagagcaatcccaacggcaagctgcggctttta
tacgagtgcgttccgatggcttttatagtgaaggaagcgggaggtctggcgacaaatgga
aaaattggtattctggacatcgttccggaaaacatccatcagagatcacctattttccta
ggctccaaggatgacgttaatgacgtaatgacatttatcaaaaataagaccgactga

DBGET integrated database retrieval system