KEGG   Pogonomyrmex barbatus (red harvester ant): 105429445Help
Entry
105429445         CDS       T04903                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: monoacylglycerol lipase ABHD12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pbar01002]
    105429445
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbar04147]
    105429445
Enzymes [BR:pbar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105429445
Peptidases [BR:pbar01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   105429445
Exosome [BR:pbar04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   105429445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Abhydrolase_2 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 105429445
NCBI-ProteinID: XP_011640717
Position
Unknown
AA seq 357 aa AA seqDB search
MMYLLLVVIVPIVILEIWYMGICLTWTMKASALMYLIIFGLLPVIFHYSYMLQKKILFLN
FVHWPLKIDFSDPKSVGLEGARNFYLHTDQQVKIGAWQILPRSLLNNSIPVTDEAYEAVL
SNAEQPIFLYMHGNSGNRASSHRLELYKLFQDLDYHVICFDYRSYGDSDVVELSEEGVVM
DSKYVLEWVMKKXNGSAPVFVWGHSLGTGVSTHVLDLLAAENMQPTGLFLEAPFNNIQDE
LTEHPFAQMFKHLPWFHWMAVEPFYKNNLRFESDKHITKIDCPIMILHAEDDGVIPVFLA
EKLYQAALDSFGNNTNRIQMIKIDSSHGLGHKYICRYEELPTIIKKFVAKAHENRTE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgatgtatctactattagtggtgatagtaccaatcgtcatccttgagatttggtacatg
ggaatatgtttaacttggactatgaaggcatcagcactgatgtatctcattatatttgga
cttttaccagtaatttttcattattcttatatgcttcaaaaaaagatactttttttaaat
tttgtacattggccacttaaaatagatttttctgacccaaaatcagttggattggaaggt
gctagaaatttttatttacataccgatcagcaagtaaagataggtgcatggcaaatatta
ccgcgatctttgttaaataattccattcctgtgacagatgaagcttacgaagcagtttta
agtaatgccgaacaacctatttttctttatatgcatggaaatagtggcaatagggcaagt
tcccatagactcgagctttataagcttttccaagacttagattatcatgttatatgtttt
gattatagaagctatggagatagtgacgtagttgaactttccgaagaaggtgtagttatg
gatagcaaatatgttcttgagtgggtaatgaaaaagnttaatggttcagctccagttttt
gtttggggtcactctttaggaactggagtctcgacacatgtattagatctgttggcagct
gaaaatatgcagccaacaggattatttctagaagcgccattcaataacatacaggatgaa
ttaaccgaacatccctttgcacaaatgttcaagcacttaccatggttccattggatggcc
gttgaaccattttataagaataatttacgatttgaatctgataaacatattactaagatt
gactgtcctattatgatattacatgctgaagatgatggtgtaattccagttttcttggca
gaaaagctttatcaagcagcattagatagttttggaaataatacaaatcgtatccaaatg
ataaaaatagattcgtctcatggacttggacataaatatatttgtagatatgaggaatta
cctactataattaaaaaatttgtcgccaaagcacacgaaaatcggactgagtaa

DBGET integrated database retrieval system