KEGG   Pogonomyrmex barbatus (red harvester ant): 105430581Help
Entry
105430581         CDS       T04903                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: farnesyl pyrophosphate synthase-like
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00900  Terpenoid backbone biosynthesis
pbar01100  Metabolic pathways
Module
pbar_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    105430581
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:pbar01006]
    105430581
Enzymes [BR:pbar01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     105430581
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     105430581
Prenyltransferases [BR:pbar01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   105430581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 105430581
NCBI-ProteinID: XP_011642508
Position
Unknown
AA seq 356 aa AA seqDB search
MTHSVTQPWVTNKDEYREMMVLWPDVVRKFADAVNTLNAPRNVRKSMAEVLQYDVRRGEK
TRGLTVVYAYRLLASNNQLTEDNIRLARILGWCVKLFQAYLFLFDDIQYRSLLRRSLPRL
YRDKDFFTAVIYNGLIIECCLNFLIREHFREKECYIDLEETFQDIMRKTIESQLTDFIST
NFYKKPNLDLFTMDHYNKIVKYKTSNYSFILPVTAAMHFAGIKDPEIFKQAKIILLKMGH
LFQVQDDYLACFGNPKVFGKDNTDIQKGKCTWLIVTTLDRATLEQRKILEECYGSSYPEK
VRRVKQLFIDLELPNAYCMYEEETYNLLNEHIQRVSRELPDSLFLDLLGKLYRRVN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgactcattccgtaacacaaccatgggtaacaaacaaggatgaatatcgagaaatgatg
gttttatggccggacgttgtccgcaaattcgcagatgcagttaatactttaaatgcacct
cgaaatgttcgaaaatctatggcagaagtattacaatatgatgtacgaagaggagaaaaa
actcgaggtttaaccgtagtttatgcctacaggttactggcatcgaataatcaacttacg
gaagataatattcgtctggcacggattttaggatggtgcgtgaaactgttccaagcttat
ttatttctttttgatgatatacaataccgatcattattacgtagaagcctgccacgtttg
tatcgagacaaagatttctttacagcggtaatatacaatggtttaataatagaatgttgt
ttaaattttctaattcgagagcattttagagaaaaagaatgctatattgacctagaagaa
acattccaggatataatgcgaaaaacaatagaaagtcaattgacagatttcatttctact
aatttctacaagaagcccaatctggatttatttacgatggatcactacaataaaattgtt
aaatacaaaacatccaattattcatttatcttaccagtgactgcagcaatgcattttgct
ggaataaaagatccagagatattcaagcaagcaaaaatcatcttgttaaagatgggacac
ttgttccaagtccaagatgattatttggcttgttttggaaatcccaaagtttttggcaaa
gataacactgatatacagaaaggaaaatgtacgtggctaattgttacaactctcgatcgc
gctactctagagcaacgtaaaattttggaagaatgttatggctcttcgtatccggagaaa
gtgagacgtgtgaagcagctcttcatcgatttggaattgccaaatgcctattgtatgtac
gaagaagaaacatataatttactaaatgaacatatacaacgggtatcacgcgagcttcca
gatagtcttttcttagatttattagggaagctttatcgcagagttaattaa

DBGET integrated database retrieval system