KEGG   Pogonomyrmex barbatus (red harvester ant): 105430728Help
Entry
105430728         CDS       T04903                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00010  Glycolysis / Gluconeogenesis
pbar00562  Inositol phosphate metabolism
pbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105430728
   00562 Inositol phosphate metabolism
    105430728
Enzymes [BR:pbar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105430728
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105430728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 105430728
NCBI-ProteinID: XP_011642707
Position
Unknown
AA seq 445 aa AA seqDB search
MFWKLSVEILLLCMVTVDISLASDYVKRNDSYKCKLGSKTPYRCVANLDESSLNYPDCVE
KKIWLILRHGTRYPGKKYVPRMIDDLPELQHVILQNYENGATNLSADDAALFKKWKLSFA
RGQMMKLAVEGENEMIDLGERYQARFPSLMPETFDNQTYKIRFTSTQRTEESARHFAIGL
FGWHNSKNIRYPLPVYKDRVIRFYKVCPRWRQEVDKNPDAQLEKTKFLNSKIVRNMLVNI
RKRIGLDIDYETAHLMHTTCAFETALNESIVSPWCKIFSLNDFKVFEYAEDLEFYWIDGY
GYPLTYEQACPALKDMFDSFGSEKGPLTTAYFTHSGTILKLTALLGIAKDAYPLTHDSFA
LREKKDKRAWRSSIIDTFASNLAFVLYDCEYYGPSILFMLQERPVYLPGCPKDRPCPLNI
MKAMYPDRDEECQFDAMCHVTKQDN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgttttggaaactatctgttgaaattctcttactttgtatggtaactgtagatatttct
cttgcttctgattatgttaaacgtaatgatagctacaaatgtaaattgggatcgaaaact
ccatatagatgtgtggccaatcttgatgaatcatcgttgaattatccagattgcgtggag
aaaaaaatttggttgattctgcgccatggaactcgatatccaggcaagaaatatgtgcct
cgtatgatagatgatttgccagagctgcaacatgtgatattacaaaattatgaaaatggc
gcaacgaatctgtcagccgatgacgcggcattgtttaagaaatggaaattatcatttgct
cgtgggcaaatgatgaaactggcagtagaaggagagaatgagatgattgatcttggagaa
agatatcaggcaagatttccatctctaatgccagagactttcgataatcagacatataaa
attagattcacttctacacaacgtactgaagaaagtgcaagacactttgctattggctta
tttggttggcataacagcaaaaatattcgatatccattaccagtgtacaaagatcgagtg
ataagattttataaggtttgtcctcgttggcgccaagaggttgacaagaatccagatgca
cagttagagaaaactaaatttctgaacagcaagattgttagaaatatgctggttaatata
agaaaacgcattggtcttgatatcgattatgaaactgcacatttaatgcatacaacatgt
gcttttgagactgctttaaatgaaagtatagtgtctccttggtgtaaaatattttcatta
aatgattttaaggtgtttgaatatgcagaagatttagaattctattggattgatggatat
ggatatccattgacatatgaacaagcatgtcctgccctgaaagacatgtttgattccttt
ggatctgagaaaggaccactgacaacagcttatttcactcattctggtacgattttgaaa
ttaacagccttactcggaatagccaaagacgcatatcctttaacgcacgactctttcgca
ctacgcgaaaaaaaagataaacgagcctggagaagcagtattattgatacattcgcatcc
aacctcgcatttgttttgtatgattgtgaatattacggacccagtattctattcatgctt
caggaacgaccggtatatttaccaggttgtccaaaagatagaccatgtccactgaatatt
atgaaagcgatgtatccagatcgtgatgaagaatgtcagtttgatgctatgtgccatgta
acgaaacaagacaattaa

DBGET integrated database retrieval system