KEGG   Pogonomyrmex barbatus (red harvester ant): 105431989Help
Entry
105431989         CDS       T04903                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial isoform X1
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00970  Aminoacyl-tRNA biosynthesis
pbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105431989
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pbar03029]
    105431989
Enzymes [BR:pbar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     105431989
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     105431989
Mitochondrial biogenesis [BR:pbar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    105431989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase rRNA_proc-arch
Motif
Other DBs
NCBI-GeneID: 105431989
NCBI-ProteinID: XP_011644843
Position
Unknown
AA seq 523 aa AA seqDB search
MMNKLLSTSIKDVSQKIYSGAVRPSEICEASIKLTSIVKPLNAYITVTSDVAEEQANAAD
NRQRQNSLLGQLDGIPIAIKDNYCVKGKPTTCASRMLANFSPGYDATVYEKLRAQGAVLI
GKTNLDEFAMGSGTVDSFYGPTRNLWGSEVLSQFYSYKSDKDSQITTRESVHEKDTWHIA
GGSSGGSAVAVATGTCYAALGSDTGGSTRNPASYCGLIGLKPTYGLISRYGLIPLLNSMD
VPGIFTRTVDDAVLILNAIAGPDQADSTTIQKEYVPIHLSETIDISNLRIGIPKEYGVEG
ISEEIQECWNDVSHLLEEAGANVVPVSLPHTDYSIVCYSVLNRCDVASNLACYDGIEYGH
RADEWNSADELYKKTRSEGFNGVVKSRILVGNYFLLAENYEEYYMKAMKVRRLITQDFDI
LWNNNIDLLLTPTTLTEAPRYNEFIQLDNQTQCLIQDHCTQPANMAGLPALNVPIKLSRG
GLPLSLQLMAPLFHEHRLFTLAKWIEQIVQFPKLKLKDSCLLK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaagctgctatctacttcgattaaagacgttagtcagaagatttatagcggt
gccgtgcgaccatccgaaatctgcgaggcctccatcaagttgacttcaattgtcaagcct
ctaaacgcttatatcactgtgacaagcgatgttgcggaagagcaagcaaatgccgccgat
aacagacaacgacaaaattcattattgggacaactcgatggcattcccatcgccattaag
gataactattgcgttaagggtaaacctacaacctgcgcttctcgaatgttggccaacttt
tccccgggttatgacgctacagtttacgaaaagctcagggcgcagggagccgttttgatc
ggcaagactaatctcgatgagttcgccatgggctccggtactgtagattcgttctacggg
ccaacgaggaatttatggggctcggaagtgctgtctcaattttattcatacaaatctgac
aaagattcacagattaccacaagggaatctgtgcatgaaaaagatacatggcatatagca
ggtggcagtagtggaggttcggcagttgcagtagccacaggtacctgctatgcagcctta
ggctctgacactggtggttccactcgtaatcccgcatcctattgtggtctaattggcttg
aaaccaacttatggtttgatatcacgttatggtcttattcctttgttaaattcaatggat
gtgcctggtattttcacgagaacagtagacgatgctgtattaattttgaatgctatagct
ggtcctgaccaggcggattccaccactatacaaaaagaatatgttccaattcatttatcc
gaaacgatagatattagtaatcttagaattgggataccaaaagaatacggagtggaaggc
ataagtgaggagattcaagaatgttggaacgatgtctctcatcttttagaagaagcggga
gctaatgtagttccagtatcattacctcatactgactactccatagtatgttattctgtt
ttaaatcgatgtgatgtagctagcaacttggcttgttacgatggcatagaatacggtcat
agagctgatgaatggaattcggctgacgaattatacaagaagactagatcggaaggtttt
aacggtgtggtcaaaagtcgtatattagttgggaattattttctcttagcggaaaattat
gaagaatattatatgaaagcgatgaaagtacgaagattaattacacaagattttgacatt
ttgtggaataataatatagatcttttgctgactccgactacattaactgaagctccgagg
tacaatgaatttatacagctagacaatcaaacacagtgcttgattcaagatcactgtaca
caacctgcaaacatggctggtttgcctgcgctcaacgtgccaatcaaattgtctcgcgga
ggactacccttatctttgcagttaatggcaccgctctttcatgaacatagactatttact
ttggcaaagtggattgaacaaatagtgcaatttccaaaactcaaattgaaagattcatgt
ctgctcaaataa

DBGET integrated database retrieval system