KEGG   Pogonomyrmex barbatus (red harvester ant): 105432007Help
Entry
105432007         CDS       T04903                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00230  Purine metabolism
pbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105432007
Enzymes [BR:pbar01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     105432007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 105432007
NCBI-ProteinID: XP_011644874
Position
Unknown
AA seq 603 aa AA seqDB search
MYGFVNYALELLVVKTFGNETWETIKKDAAVNMEGQFLVRQIYEDEITYNLISAAVNKLN
IPADEILELFGRMFFEFCQDSGYDKILQVLGATPRDFLQNLDALHDHLGTLYPGMRAPSF
RCTERPEDGALILHYYSDRPGLEHIVIGIVKTVAKKLHGTDVDMQIVKTKSECDHVQFLI
TDTSGPGVVSNPMIAELETLSVEPRVSPTTFCRVFPFHLMFNRDLTIVQTGCTITRVIPR
VCSGHCKLNDILLTVRPHLELTFENILSHINTVYVLKTXKGVMRVDASEEYSNLRLKGQM
LYIPETDLVIFLCYPSVMNLDDLTRRGLYLSDVPLHDATRDLVLMSEQFEADYKLTRNLE
LLTDKLQQTYRELDGEKQKTDRLLYSVLPISVANELRHSRPVPAKKYDCVTLLFSGIVGF
GAYCAAHTDSNGAMKIVNMLNELYTAFDVLTDPKKNPNVYKVETVGDKYMAVSGLPEPCR
CHARCIARLALDMMDLAADEVQIDGEPVKITIGIHSGEVVTGVIGHRMPRYCLFGNTVNL
TSRTETTGQPGKINVSEDAYRYLCMPENQDPQFLLEYRGPVSMKGKSEPMNVWFLSRERE
LTS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgtacggttttgtgaattacgccctcgagctcctggtcgtgaagaccttcggcaacgaa
acgtgggagacgataaaaaaagatgcggcagttaatatggaaggacagtttctggtacga
caaatctacgaagatgaaattacgtataatttgatatccgctgctgtcaataagcttaat
attccagccgatgaaatacttgaattatttggtcgaatgttcttcgagttctgccaagat
tccggttatgacaagattcttcaagttcttggagcaacacctagagattttttgcagaat
ctggatgcgcttcatgatcatttgggtacgttatatccgggcatgagggcaccatcgttt
agatgtacagaaagaccagaggatggtgcgcttatcttgcattattattcggatcgacct
ggtttggagcatatcgttattggaattgttaagacggtcgcgaaaaaactgcacggtacg
gacgttgacatgcagatagtgaagactaaaagcgaatgcgatcatgtgcaatttctcata
actgacacatcagggccaggagttgtatcaaatcctatgatcgctgagctggaaacattg
tctgttgagccaagggtcagtccaacgacattttgtcgagtttttccatttcatctaatg
tttaatcgggaccttacgatagttcaaaccggatgtaccataactcgtgttataccgcgc
gtctgcagtggtcattgcaaactaaacgacattctcttaactgtcagaccgcacctggaa
ttaacattcgagaatatattgtcgcatattaatacggtatatgtgttaaaaacgnaaaag
ggagttatgcgtgtcgatgcttcagaggagtattctaatttacgtttaaagggacaaatg
ttgtatatacctgagaccgatttagtcatctttctgtgttatccaagtgttatgaatctg
gatgacttaaccaggcgaggtctgtatttgagcgacgtccctctgcacgacgccactcga
gatctggtcctgatgtcggagcaatttgaggcggattacaaactgacgcgcaacttggaa
ttactcaccgataagctgcaacagacgtatcgcgagctcgatggcgagaagcagaagacc
gacaggttgctttactcggtgcttcctatttcggtggcgaacgagctcaggcattcaaga
ccggtaccggcaaaaaagtacgattgcgttacccttctcttctccggtatagtcggtttt
ggagcttattgcgccgctcacacagactccaacggcgctatgaaaatcgttaacatgctc
aatgaattgtacacagctttcgatgtgttgactgatccgaaaaaaaatcccaacgtgtat
aaggtggagactgtcggtgataaatatatggcagtgagtggattgccggaaccctgtcgt
tgtcatgcacgatgcatcgcccgtctagcgttggacatgatggatctcgcggcggacgaa
gtgcagatcgatggagaacccgtgaaaattacaattggtatacatagtggagaagttgtt
actggcgtaattggtcatcgtatgcctcgttattgtttgttcggaaatactgtaaatctt
acaagtcgaacagagaccaccggccagcctggaaaaattaacgtttcggaagacgcttac
aggtatctttgcatgccagaaaatcaagatccgcagttccttttggaatacagaggtcct
gtttcaatgaaaggaaaatccgagcctatgaacgtgtggttcctgtccagagaaagagaa
ctgacatcgtaa

DBGET integrated database retrieval system