KEGG   Oblitimonas alkaliphila: AKN87_05525Help
Entry
AKN87_05525       CDS       T04152                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pbb  Oblitimonas alkaliphila
Pathway
pbb00071  Fatty acid degradation
pbb00072  Synthesis and degradation of ketone bodies
pbb00280  Valine, leucine and isoleucine degradation
pbb00310  Lysine degradation
pbb00362  Benzoate degradation
pbb00380  Tryptophan metabolism
pbb00620  Pyruvate metabolism
pbb00630  Glyoxylate and dicarboxylate metabolism
pbb00640  Propanoate metabolism
pbb00650  Butanoate metabolism
pbb00900  Terpenoid backbone biosynthesis
pbb01100  Metabolic pathways
pbb01110  Biosynthesis of secondary metabolites
pbb01120  Microbial metabolism in diverse environments
pbb01130  Biosynthesis of antibiotics
pbb01200  Carbon metabolism
pbb01212  Fatty acid metabolism
pbb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AKN87_05525
   00630 Glyoxylate and dicarboxylate metabolism
    AKN87_05525
   00640 Propanoate metabolism
    AKN87_05525
   00650 Butanoate metabolism
    AKN87_05525
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AKN87_05525
   00072 Synthesis and degradation of ketone bodies
    AKN87_05525
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AKN87_05525
   00310 Lysine degradation
    AKN87_05525
   00380 Tryptophan metabolism
    AKN87_05525
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AKN87_05525
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AKN87_05525
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AKN87_05525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbb04147]
    AKN87_05525
Enzymes [BR:pbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AKN87_05525
Exosome [BR:pbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AKN87_05525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKX45821
Position
complement(1151508..1152695)
Genome map
AA seq 395 aa AA seqDB search
MHDDPVVIVSMARTPMGGFQGELKDKTAPELGAAAIKGAVERAQLDPNAIEEVMFGCVLP
AGLGQAPARQAALGAGLNKHTVCTTVNKMCGSGMQTVIMAHDALLAGSVKVIVAGGMESM
SNAPYLLDKARAGYRMGHGKVIDHMFFDGLEDAYDKGRLMGTFAEDSAQAYGFSRQEQDD
FAIQSLERAQQAMQQGVFSDEIVAVEVAQRKQTVTISEDEQPPKADVSKIRQLRPAFSKD
GTVTAANSSSISDGAAALVLMRESEAKQRGLTPMAAIRGHSAYAAEPHLFTTAPVGAINK
LMQRTGWSLDQVDLFEINEAFAVVTMIAMRELDLAADKVNIRGGACALGHPIGASGARII
VTLLSALKQQNKRYGVASLCIGGGEATALAVELLN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatgatccagtggttattgtcagtatggcccgtactcctatgggtggctttcaa
ggtgaactaaaagataaaacagctcccgagttaggagctgcagccattaagggcgcagtc
gagcgggcgcaacttgatccgaatgcgattgaggaagttatgtttggttgtgtgttgccc
gctggtttaggtcaagcacccgcacgtcaggccgcactaggagcaggtttaaataaacat
acggtgtgtaccacggtaaataaaatgtgtggttccggtatgcaaaccgtcatcatggcc
catgatgcgttattggcgggttcagtgaaggtgattgtcgcaggtggaatggagagcatg
tcgaatgcgccatatcttttagacaaagcacgtgctggctatcgcatggggcacggtaaa
gtgattgatcatatgttctttgatggtttggaagatgcgtatgataaaggccgcctaatg
ggcacctttgctgaagacagtgcccaagcctatggtttttctcgtcaagaacaagatgat
tttgctattcagtcattagaacgcgcacagcaagcgatgcagcagggtgtgtttagtgat
gaaattgtagcggtagaagtggcgcagcgtaaacaaacagtcactatcagcgaagatgag
caaccgccaaaggctgatgtcagcaagattcgtcagttgcgtccagcctttagtaaggac
ggtaccgtcactgcggctaattccagttcaatttctgatggagccgcggcgttagtttta
atgcgtgaaagtgaagccaagcagcgtggtttaacgcctatggcagcgattcgtgggcac
agcgcttatgccgcagaacctcatctttttaccaccgcgccagtgggagcaattaacaag
ctgatgcagcgcacaggctggtcgttggatcaagtggacttgtttgaaatcaacgaagcc
tttgcggtggtcactatgatcgctatgcgtgagctagatttggcggcagataaagtgaat
atacgcggtggtgcttgtgctttagggcatccaataggtgcatctggcgcgcgaattatt
gtcactttgttatcggcactgaagcaacaaaataaacgttatggagtggcttcgttatgc
attggtggtggtgaagctaccgcccttgccgtggagttgctaaattaa

DBGET integrated database retrieval system