KEGG   Pseudomonas brassicacearum DF41: CD58_03610Help
Entry
CD58_03610        CDS       T03174                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00260  Glycine, serine and threonine metabolism
pbc01100  Metabolic pathways
pbc01110  Biosynthesis of secondary metabolites
pbc01120  Microbial metabolism in diverse environments
pbc01130  Biosynthesis of antibiotics
pbc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD58_03610
Enzymes [BR:pbc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CD58_03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AHL32037
UniProt: W8PM33
Position
819171..820232
Genome map
AA seq 353 aa AA seqDB search
MFIDLRSDTVTKPTEGMRKAIYQAEVGDDCFGEDPTVRALEEYCATYFQKEAALFTAGGT
LSNQLAIKALTNPGDEIFLDASYHINFYESASTSAFSGVNFSLSNHDNGLFDVSDLEKLH
ASKCRWSQNYALPRVVVIENTLGCKGGAVFPLQQMNDVFTYAKDIGAYRYLDGARILHAS
IASGIDVTSYTDNADLLSMCLSKGLGAPIGSIMVGSQELILRAKKYRKWFGGDLHQAGMM
AAAGLYAMQNHIERLVEDHEHAALLYRLLNDIDEAPARYKGTNMVTLDIAALGITPVQFA
AHLRQKGVGGLPYNAREMRFMPHINITRDDIYKAVGIIKDTVRELSQAREAVK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtttatcgatctcagaagcgatacggtgaccaagccaacggaaggcatgcgcaaggcg
atttaccaggcagaagtaggtgatgattgcttcggtgaagacccgactgtgcgtgcgttg
gaggagtactgcgccacttacttccagaaggaagcggcgctgttcaccgcgggcggcacc
ttgagcaaccagttggcaatcaaggccctgacgaatccgggtgacgagatattcctggac
gcctcgtaccacatcaatttctatgagtccgcctcgacgtcggccttttcaggggtcaac
ttttcgctttccaaccacgacaacggcctgttcgacgtcagtgacctggaaaagctccat
gcctccaaatgccgctggagccagaactacgctctgccacgagtcgtggtgattgaaaac
acactcgggtgtaaaggcggtgcagtctttcctttgcagcaaatgaacgatgtctttacg
tacgccaaggatatcggggcctatcgttatctcgacggtgcccggattctccatgcgtcg
attgcctccggcattgacgtgacgtcctacaccgataacgccgatctcttgtccatgtgc
ctgtcaaaaggcctgggagcaccgatcggttcgatcatggtgggctcgcaggaactgata
ctgcgtgccaagaaataccgcaaatggtttggcggcgatctgcaccaggccggcatgatg
gcggctgccgggctttatgcgatgcaaaaccacatcgagcggctggtcgaagaccatgag
cacgcggcgttgctgtaccggttgctcaacgacatcgacgaggcgcccgcacgctacaag
ggcaccaacatggtcaccctggatattgccgcgctgggtattactccggtgcagttcgcg
gctcatctgcgtcagaaaggggtggggggcttgccttataacgccagggaaatgcgcttc
atgccacatatcaacattacccgcgacgatatttataaagccgtcggtatcatcaaggat
accgtccgagagctcagtcaggcgcgggaggcggtcaagtga

DBGET integrated database retrieval system