KEGG   Pseudomonas brassicacearum DF41: CD58_12930Help
Entry
CD58_12930        CDS       T03174                                 

Definition
(GenBank) bifunctional glyoxylate/hydroxypyruvate reductase B
  KO
K00032  phosphogluconate 2-dehydrogenase [EC:1.1.1.43]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00030  Pentose phosphate pathway
pbc00480  Glutathione metabolism
pbc01100  Metabolic pathways
pbc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CD58_12930
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CD58_12930
Enzymes [BR:pbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.43  phosphogluconate 2-dehydrogenase
     CD58_12930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AHL33741
UniProt: W8PVL3
Position
complement(2847540..2848517)
Genome map
AA seq 325 aa AA seqDB search
MKKHVVLYKALSAQLMARLQAQAQVTLIERLNAQGLVQLREALPSAHGLLGASLKLDAPL
LDLAPNLQAIASVSVGVDNYDIDYLTERRILLTNTPDVLTETTADTGFALILATARRVVE
LANLVRSGGWQQSIGPKHFGSDVHGKTLGIIGMGRIGEALAQRGHFGFGMPVLYHSHSPK
PAVEQRFNARYCSLETLLQQADFVCLTLPLTAETQGLIGAQAFARMRPETLFINISRGKV
VDEAALIDALRSGQIRGAGLDVFEREPLSADSPLLQLDNVVATPHMGSATHETREAMARC
AVDNLLAALAGERPVNLVNAGAWVG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcacgtggtgttgtacaaggcgctgtcagcgcaattaatggcccgtttgcaa
gcccaggcccaagtcacgctcatcgagcgcctcaacgcgcagggcctggtgcaactgcgc
gaggccttgccaagcgcccatggcttgctgggtgccagcctcaaactggacgcgccgttg
ctggacctggcgccgaacctgcaagccatcgccagcgtctcggtgggggtcgacaactac
gacatcgactacctgaccgaacgccggatcctgctgaccaataccccggacgtgctcacc
gaaaccaccgcggacaccggtttcgccctgatcctggcaaccgcccgccgcgtggtggaa
ctggccaacctggtgcgcagcggcggctggcaacagagcatcggccccaagcatttcggc
agcgacgtccatggcaagaccctgggcatcatcggcatgggccgcatcggcgaagccttg
gcccagcgcgggcacttcggcttcggcatgccggtgctctaccacagccactcgccaaaa
cccgcggtcgagcagcgtttcaatgcacgctattgcagcctcgaaacattgttgcagcag
gcggacttcgtttgcctgaccttgcccttgacggctgaaacccaaggactgatcggcgcc
caggcgtttgcccgaatgcgtcccgagaccctcttcatcaatatctcccggggcaaggtg
gtggacgaagcggccctgatcgacgccctgcgcagcggccagatccgtggcgcggggctg
gacgtgttcgagcgcgagcccttgagtgcggattcgccgctgttgcaactggataatgtg
gtggcgacaccgcacatgggctcggccacccatgagacacgggaagcgatggcgcgttgt
gcggtggataatctgctggcggcattggcgggtgaacggccggtgaatctggtgaatgcg
ggggcgtgggtaggctga

DBGET integrated database retrieval system