KEGG   Pseudomonas brassicacearum DF41: CD58_14585Help
Entry
CD58_14585        CDS       T03174                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00071  Fatty acid degradation
pbc00072  Synthesis and degradation of ketone bodies
pbc00280  Valine, leucine and isoleucine degradation
pbc00310  Lysine degradation
pbc00362  Benzoate degradation
pbc00380  Tryptophan metabolism
pbc00620  Pyruvate metabolism
pbc00630  Glyoxylate and dicarboxylate metabolism
pbc00640  Propanoate metabolism
pbc00650  Butanoate metabolism
pbc00900  Terpenoid backbone biosynthesis
pbc01100  Metabolic pathways
pbc01110  Biosynthesis of secondary metabolites
pbc01120  Microbial metabolism in diverse environments
pbc01130  Biosynthesis of antibiotics
pbc01200  Carbon metabolism
pbc01212  Fatty acid metabolism
pbc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pbc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CD58_14585
   00630 Glyoxylate and dicarboxylate metabolism
    CD58_14585
   00640 Propanoate metabolism
    CD58_14585
   00650 Butanoate metabolism
    CD58_14585
  Lipid metabolism
   00071 Fatty acid degradation
    CD58_14585
   00072 Synthesis and degradation of ketone bodies
    CD58_14585
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CD58_14585
   00310 Lysine degradation
    CD58_14585
   00380 Tryptophan metabolism
    CD58_14585
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD58_14585
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CD58_14585
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CD58_14585
Enzymes [BR:pbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CD58_14585
Exosome [BR:pbc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD58_14585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417
Motif
Other DBs
NCBI-ProteinID: AHL34061
UniProt: W8PWJ9
Position
3224800..3225987
Genome map
AA seq 395 aa AA seqDB search
MSNDPIVIVSAVRTPMGGFQGELKSLSAPQLGAAAIKAAVERAGIAPTAVEEVLFGCVLA
AGLGQAPARQAALGAGLDKSARCTTLNKMCGSGMEAAILAHDMLIAGSAEVVVAGGMESM
SNAPYLLDRARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAEANGLSREAQDA
FAIASTTRAQQAIKDGSFEAEIVPLTVTVGKEQVLISHDEQPPKAKLDKIKSLKPAFREG
GTVTAANASSISDGAAALVLMRQSQALQRGLKPLAVIHGHAAFADTPSLFPTAPIGAVKK
LLHKTGWSLDEVDLFEVNEAFAVVGLVAMHQLDIPHEKVNVHGGACALGHPIGASGARIL
VTLLSALRQKGLKRGVAAICIGGGEATAMAVECLY
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgatccgattgtcattgtcagcgccgtccgcacccccatgggcggtttccag
ggtgaactgaaaagcctcagcgccccccaactgggagcggccgccatcaaggccgccgtg
gagcgagccggcattgcgcccactgcggttgaagaagtgctgtttggttgcgtgctcgcg
gctggcctgggccaggccccggcccggcaggcggcgctgggggccgggctcgacaagtcg
gcccgttgcaccacgctcaacaagatgtgcggttcgggcatggaagcggcgattctcgcc
catgacatgctcatcgccggcagtgccgaggtggtggtggccggcggcatggaaagcatg
tccaacgccccgtatctgctcgatcgcgcccgtagcggctaccgcatgggccacggcaag
gtgctggatcacatgttcttagacggcctcgaagacgcctacgacaagggccgcctgatg
ggcaccttcgccgaggattgcgccgaagccaacggtttgagccgtgaagcccaggatgcc
tttgccattgcctccaccacccgcgcccaacaagcgatcaaggacggcagtttcgaggcc
gagatcgtgccgctgacggtgaccgtcggcaaagagcaggtactgatcagccacgacgaa
cagccgccgaaagccaagctggataagatcaagtcgctcaagccggcattccgtgagggc
ggcacagtaacagcggccaacgccagttccatctccgatggcgcagcggccctggtgctg
atgcgccagagccaggcgctgcagcggggcttgaagcccttggcggtgattcatgggcat
gcggcgtttgccgacaccccaagcctgtttccgacggcgccgattggcgcggtgaaaaaa
ctgctgcacaaaaccggttggtcgctggatgaagtcgatctgttcgaagtcaacgaagcc
tttgccgtggtgggattggtcgccatgcaccaattggacatcccccatgaaaaggtcaat
gttcacggtggcgcttgcgccctgggccacccaatcggcgcatccggcgcacggatcctg
gtgacgctgctctcggccctgcgccagaaaggcctcaagcgcggcgtcgcggcaatttgc
atcggcggcggcgaagccacggccatggccgtcgaatgcctgtattaa

DBGET integrated database retrieval system