KEGG   Pseudomonas brassicacearum DF41: CD58_15705Help
Entry
CD58_15705        CDS       T03174                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00740  Riboflavin metabolism
pbc00790  Folate biosynthesis
pbc01100  Metabolic pathways
pbc01110  Biosynthesis of secondary metabolites
Module
pbc_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pbc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CD58_15705
   00790 Folate biosynthesis
    CD58_15705
Enzymes [BR:pbc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CD58_15705
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CD58_15705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AHL34265
UniProt: W8QDE2
Position
3491766..3492875
Genome map
AA seq 369 aa AA seqDB search
MAFNSIQEIIEDYRLGKMVLLVDDEDRENEGDLLLAADCCSAQAISFMAREARGLICLTL
TDEHCQRLGLEQMVPSNGSVFSTAFTVSIEAATGVTTGISAADRARTVAAAVAADAGPSD
IVQPGHIFPLRAKEGGVLTRAGHTEAGCDLARLAGFTPASVIVEVMNDDGTMARRPDLEV
FARKHGIKIGTIADLIHYRLSTEHTVLRIGERELPTVHGTFRLFTFEDRIEGGVHMAMVM
GDIRREEPTLVRVHVIDPLRDLVGAEYNGPSNWTLWAALQRVAEEGCGVVVVLANHESSQ
ALLERVPQLTQPPRQFSRSQSRIYSEVGTGAQILQDLGVGKLRHLGPPLKYAGLTGYDLE
VVESIAFTG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcctttaacagcattcaggaaatcatcgaagactaccgcctgggcaagatggtgttg
ctggtggatgacgaagaccgggaaaacgaaggcgacctgctgctggccgccgactgttgc
agcgcccaagccatcagcttcatggcccgggaagcccgtggcctgatctgcctgaccttg
accgacgagcactgccagcgcctgggcctggaacagatggtgccgagcaacggcagcgtg
ttcagcacggcgttcacggtctccatcgaggccgccacgggtgtgaccactggcatttcc
gccgccgaccgggcacgcaccgtcgccgcagccgttgccgccgacgcggggcccagcgat
atcgtgcagccggggcatatcttcccgttgcgcgccaaggaaggcggcgtgctgactcgc
gccgggcacaccgaagccggttgcgacctggcgcgcctggccggcttcacgccagcatcg
gtgatcgtcgaagtgatgaacgacgacggcaccatggcccgccgcccggacctggaggtg
ttcgcccgcaagcacgggatcaagatcggcaccatcgccgacctgatccactatcgcctg
agcaccgaacacaccgtgctgcgtatcggtgaacgggagttgcccacggtgcacggcacc
ttccggctgtttaccttcgaagatcgcatcgaaggcggcgtacacatggcgatggtcatg
ggtgacattcgccgggaagaaccgaccctggtgcgggtgcacgtgatcgacccgttgcgg
gacttggtcggcgccgaatacaacggtccttccaactggacactgtgggcggcgctgcaa
cgagtcgctgaagaaggctgcggcgtggtggtcgtgctggccaaccatgagtcgtcccag
gcgctgctcgagcgcgtgccacagctcactcagccgccacgacagttcagccgctcccaa
tcacgcatctattctgaagtgggcaccggggcgcagattctgcaggacctgggcgtcggt
aagttgcgtcacctggggccgccgctcaagtacgcaggactaactgggtatgacctggaa
gtggtggagagtatcgcgtttaccggataa

DBGET integrated database retrieval system