KEGG   Pseudomonas brassicacearum DF41: CD58_17890Help
Entry
CD58_17890        CDS       T03174                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00900  Terpenoid backbone biosynthesis
pbc01110  Biosynthesis of secondary metabolites
pbc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pbc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD58_17890
Enzymes [BR:pbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     CD58_17890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AHL34657
UniProt: W8PUB9
Position
4087614..4088900
Genome map
AA seq 428 aa AA seqDB search
MSIDSRLPMFRNLSPAERLGHLQALLELPEADVALLRDAGALPLEIADGMIENVIGKFEL
PYAVASNFQINGRDVIVPLVVEEPSVVAAASFMAKLARDAGGFQTSSSLPLMRAQVQIVE
VEDPFNARLSLLRRKDEIIELANRRDQLLNTLGGGCRDIEVHTFAQSPRGPMLVAHLIVD
VRDAMGANTVNTMAEAVAPLMEEITGGKVRLRILSNLADLRLARAQIRIAPELLTTAAYK
GEDVIEGILDAYNFAVIDPYRAATHNKGIMNGIDPLIVATGNDWRAVEAGAHAYACRNGH
YGSLTTWEKDGKGHLVGTLEMPMPVGLVGGATKTHPLAQLSLRILGVKTAQELAEIAVAV
GLAQNLGALRALSTEGIQRGHMALHARNIALSAGAKGEELNWLVKQMVEAGDVRSDKAAE
LLKQKRAQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgactcccgcctccccatgttccgcaacctgtcgcccgccgaacgcctgggc
catttgcaggcgctgcttgagcttccagaagcggatgttgcccttctacgcgatgccggc
gccctccccttggaaattgccgacggcatgattgagaacgtgattggcaagttcgaattg
ccctacgccgtcgcgagtaacttccaaatcaatggtcgtgacgtcatcgtgccgttggtg
gttgaagagccgtcagtggtcgcagcggcttcgttcatggccaagctggcacgcgatgcc
ggtggtttccagacctccagttctctgccgctgatgcgagcccaggtgcagattgtcgag
gtcgaagatcccttcaatgcacgtctgagccttttgcggcgcaaagacgaaatcatcgaa
ctcgccaaccgcagggatcaactgcttaacacactgggcggcggctgccgcgacattgaa
gtacacacctttgcccagagccctcgcgggccgatgctggtagcccacctgatcgtggat
gtgcgcgatgccatgggcgccaacaccgtgaacaccatggctgaagcggttgccccgctg
atggaagaaattaccggaggcaaggtacgactgcgcattctgtccaacctggcggatctg
cgtcttgccagggcccagatccgcattgcccctgagctgctcacgaccgcagcctataaa
ggcgaagacgtcattgaggggatcctcgatgcttacaactttgctgtcatcgacccctat
cgtgcagccacccacaacaagggcatcatgaatggcatcgacccccttatcgtcgccacg
ggtaacgactggcgcgcggtggaagccggcgctcacgcctatgcctgccgtaatggccat
tacggttcgctgaccacgtgggaaaaagatggcaagggtcatctggtgggcaccctggaa
atgcccatgcctgttggcctggtcggcggcgccacgaagactcacccactggcacaactg
tcgctccgcatcctgggtgtgaagacggcgcaggaactcgccgaaatcgcggtggcagtg
ggcctggctcaaaacctgggcgcactgcgtgcattgtcgacggaaggaatacaacgcgga
cacatggctttgcatgcgcgcaacattgcgctttccgcaggtgccaaaggcgaagagctc
aattggctggtcaagcagatggttgaggcgggggatgtgcgttcagacaaagcggctgaa
ttactcaagcaaaagcgcgcgcagtga

DBGET integrated database retrieval system