KEGG   Pseudomonas brassicacearum DF41: CD58_21145Help
Entry
CD58_21145        CDS       T03174                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00071  Fatty acid degradation
pbc00072  Synthesis and degradation of ketone bodies
pbc00280  Valine, leucine and isoleucine degradation
pbc00310  Lysine degradation
pbc00362  Benzoate degradation
pbc00380  Tryptophan metabolism
pbc00620  Pyruvate metabolism
pbc00630  Glyoxylate and dicarboxylate metabolism
pbc00640  Propanoate metabolism
pbc00650  Butanoate metabolism
pbc00900  Terpenoid backbone biosynthesis
pbc01100  Metabolic pathways
pbc01110  Biosynthesis of secondary metabolites
pbc01120  Microbial metabolism in diverse environments
pbc01130  Biosynthesis of antibiotics
pbc01200  Carbon metabolism
pbc01212  Fatty acid metabolism
pbc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CD58_21145
   00630 Glyoxylate and dicarboxylate metabolism
    CD58_21145
   00640 Propanoate metabolism
    CD58_21145
   00650 Butanoate metabolism
    CD58_21145
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CD58_21145
   00072 Synthesis and degradation of ketone bodies
    CD58_21145
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CD58_21145
   00310 Lysine degradation
    CD58_21145
   00380 Tryptophan metabolism
    CD58_21145
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD58_21145
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CD58_21145
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CD58_21145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbc04147]
    CD58_21145
Enzymes [BR:pbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CD58_21145
Exosome [BR:pbc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD58_21145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHL35221
UniProt: W8PZJ0
Position
complement(4795833..4797038)
Genome map
AA seq 401 aa AA seqDB search
MTQALIFDALRTPRGKGKADGALHSVKPVNLMAGLLVALQQRMSLDTSQVDDIVLGCVTP
VGEQGADIAKTASLMADWDVSVAGVQLNRFCASGLEAVNLAAMKVRSGFEELVVAGGVES
MSRVPMGSDGGAWALDPQSNMHGHFTPQGIGADLIATLEGFSRTDVDAYALHSQQKAARA
RADGSFAKSLVAVRDQNGIVLLDHDEFIRADSTLEGLGKLKPSFEAMGQTGFDGTALRVY
SHVERINHVHTPGNSSGIVDGAALMLIGSEAKGREMGLQPRARIVATAVTSTDPTIMLTG
PAPATRKALAKAGLRVEDIDLFEVNEAFASVVLKFIKDMAIDPARVNVNGGSIAMGHPLG
ATGCAILGTLLDELEVRRLRYGLATLCVGGGMGIATVIERL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagctttgattttcgacgcactgcgcacgcctcgcggcaaaggcaaggccgat
ggcgctttgcacagcgtcaagccggtgaacctgatggctggcctgctcgtcgctttgcaa
cagcgcatgagcctggacaccagccaggtcgacgatatcgtgctgggttgcgtaacgccg
gtgggggagcagggcgccgacatcgccaagaccgcctcgctgatggccgattgggatgtc
agtgtggcgggcgtgcaactcaatcggttttgcgcctcgggcctggaagcggtgaacctg
gcggccatgaaagtgcgatccggcttcgaggaactggtggtggctggcggcgttgaatcc
atgtcccgggtgcccatgggcagtgatggcggcgcctgggcgctcgacccgcaatccaac
atgcacgggcacttcactccccagggcatcggcgccgatctgatcgccaccctggagggc
ttcagccgcacggatgtcgatgcctatgcgctgcactcccagcaaaaagccgcgcgggcc
cgggctgacggttcgttcgccaagtccctggtggcggtgcgggaccagaatggcatcgtc
ctgctggaccatgacgaattcattcgcgccgactccacgctcgagggcctgggcaagctc
aagccgagtttcgaagccatgggccagacgggttttgacggcacggcgctgcgggtctac
agccatgtcgaacgaatcaaccatgtgcacacgccgggcaacagttccggcatcgtcgat
ggtgctgcgctgatgttgatcggttccgaggccaaggggcgtgagatgggcctgcaaccc
cgggcacggatcgtcgccacggccgtcaccagcaccgacccgaccatcatgctcaccggc
ccggcgccggccacccgcaaggccttggccaaggcaggcctgcgagtggaggacattgac
ctgttcgaagtcaacgaagccttcgcctcggtggtgctcaagttcatcaaggacatggcc
atcgaccccgccagggtcaacgtcaacggcggctccatcgccatgggccatcccttgggc
gctaccgggtgcgcaatcctcggcaccctgctcgatgagttggaggtgcggcgcctgcgc
tatggcctggcgaccctgtgtgtcggcggcggcatgggcattgccaccgttatcgaacgc
ctctga

DBGET integrated database retrieval system