KEGG   Pseudomonas brassicacearum DF41: CD58_26360Help
Entry
CD58_26360        CDS       T03174                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc00740  Riboflavin metabolism
pbc00790  Folate biosynthesis
pbc01100  Metabolic pathways
pbc01110  Biosynthesis of secondary metabolites
pbc02024  Quorum sensing
Module
pbc_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pbc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CD58_26360
   00790 Folate biosynthesis
    CD58_26360
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CD58_26360
Enzymes [BR:pbc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CD58_26360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AHL36172
UniProt: W8PYE0
Position
complement(5911507..5912124)
Genome map
AA seq 205 aa AA seqDB search
MPVVFVAASKLPTPFAQFTMHGFLDEATGREHVVLSLGDFADGAPVLGRLHSECLTGDAL
FSQRCDCGSQLEAALRAIAREGRGVLLYLRQEGRGIGLLNKIRAYELQDGGADTVEANER
LGFAADMRDYSICLPMLEHLGIQSLRLMTNNPRKVKALTDMGIVVAERVPLHTGHNPHNK
LYLATKASKLDHMMGNEHQGEVDRA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcgtttttgttgccgcttccaagctgccaacgccctttgcgcaattcaccatg
catggttttctcgatgaagccaccggccgcgagcacgttgtgttgagcctgggtgatttc
gccgacggagccccggtacttggccgcctgcactccgaatgcctgacgggcgatgccctg
ttcagccagcgctgcgactgcggttcgcaactcgaagccgcactgcgggccatcgcccgc
gaaggccgtggcgtgttgctgtacttgcgccaggaaggccgcggcattggcctgttgaac
aagatccgcgcctatgagttgcaagacggtggcgccgataccgtggaggctaacgagcgc
ctcgggtttgccgccgacatgcgtgactacagcatctgcctgccgatgctcgagcacctg
ggcatccagtcgttgcgcttgatgaccaataacccacgcaaggtcaaggcgttgaccgac
atgggtatcgtggtcgccgagcgtgtgccgctgcacaccggtcacaacccgcacaacaaa
ctgtatctggcgaccaaggccagcaagctcgaccacatgatgggtaacgagcaccagggc
gaggtcgaccgggcgtga

DBGET integrated database retrieval system