KEGG   Paenibacillus borealis: PBOR_09215Help
Entry
PBOR_09215        CDS       T03324                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pbd  Paenibacillus borealis
Pathway
pbd00051  Fructose and mannose metabolism
pbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PBOR_09215
Enzymes [BR:pbd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     PBOR_09215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N 3HCDH_N ApbA TrkA_N Sacchrp_dh_NADP NAD_binding_2 Methyltransf_25 NAD_binding_10 DIOX_N
Motif
Other DBs
NCBI-ProteinID: AIQ57089
UniProt: A0A089MKK3
Position
2099922..2101067
Genome map
AA seq 381 aa AA seqDB search
MKAVHFGAGNIGRGFIGLLLSQAGYQVTFVDVNEAFVSQLQERGEYPVTLASDGQETVIV
KNVTALSSVTHGEEVAAAIAEADLVTTAVGVSILKHIAGVLADGISRRVAVSSAPLHVIA
CENAIGGSAQLKELVYAKLDEAARAKADASVAFPNAAVDRIVPLQQHEDILKVVVEPFYE
WVVDSSQMIPGYTPVEGVHYVDNLEPYIERKLFTVNTGHCSAAYLGFLRGYETIQQAMAD
EALTAQVREVLEETGAVLIQKHGFDQAEHSKYIDKILERFRNPALTDEVSRVGRSPLRKL
SPNDRLVSPALQAYDRGLSYAALTRSMAGAMLFKVSDDPEAVDLQAAIAELGAEAALAKY
TGIAADHPVHKSAMEQYAKLK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtccatttcggcgcgggcaacatcggcagaggtttcatcggactgctgctg
tcgcaggcagggtatcaagtaactttcgtggatgtaaatgaggcgtttgtatcccagctt
caggagcgcggcgagtatccggtaacgctggccagcgatggtcaggaaacggtaatcgtc
aaaaatgtaactgcactcagcagcgtaactcacggtgaagaagttgcagctgccattgct
gaagccgatctggttaccaccgctgtcggcgtgtcgattctgaagcatattgcaggtgtg
ctggctgatggcatcagcagacgggtagcggtctcttccgcaccgctgcatgtaattgcc
tgcgagaacgcgattggcggcagtgcccagctcaaagagctggtctatgccaagcttgat
gaagcagcccgcgccaaagcggacgcttctgttgccttcccgaacgcggctgtggaccgg
attgttccgctgcagcagcatgaggatattctgaaggtggtcgtagagccattctatgag
tgggtcgtagattcctcccagatgatcccgggctatacaccggttgaaggtgtgcactac
gtggataacctggagccttatatcgagcgtaaattgttcactgttaatacaggacactgc
tccgcagcttatcttggcttcctgcgcgggtacgaaaccatccagcaggctatggcggat
gaagctttgactgcacaggtccgtgaagtgctggaagaaacgggtgcggtgctgattcag
aagcatggcttcgatcaggcagaacacagcaagtatatcgacaaaatccttgagcgcttc
cgcaatccggcgctgaccgatgaagtgtcacgtgtaggccgttcgccgctgcgcaagctg
tcgccgaatgaccgtctggtgtctcctgctctgcaggcatacgacagagggctcagctat
gctgccctgacccgctctatggccggcgcgatgctgttcaaggtcagtgatgacccggaa
gcagtggatctgcaggcagcgattgccgagcttggcgcagaagcagccctggcgaaatat
accggcattgctgctgatcatccggttcataagtccgcgatggagcaatatgcgaagctg
aaataa

DBGET integrated database retrieval system