KEGG   Paenibacillus borealis: PBOR_14430Help
Entry
PBOR_14430        CDS       T03324                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
pbd  Paenibacillus borealis
Pathway
pbd00511  Other glycan degradation
pbd00600  Sphingolipid metabolism
pbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    PBOR_14430
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PBOR_14430
Enzymes [BR:pbd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PBOR_14430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-ProteinID: AIQ57992
UniProt: A0A089LB16
Position
complement(3362460..3363806)
Genome map
AA seq 448 aa AA seqDB search
MSSTTVRVIQTAQGTGDRLTELQPLSFRPDSEEKEMELINIYEDLEYQEIEGFGGALTEA
SAVTLAKLSPARQQEIIDAYFHPEHGIGYTLCRSHIQSCDFSTGNYAYVEGVDPELATFN
ISRDQESILPLIKRAADSVGESFRLFSSPWSPPAFMKTNGEMNNGGKLKPEYREAWANMF
VKYIQAYAEAGIDIWAVSVQNEAKAKQIWDSCIYTAEEEKDFVRDYLGPALEAAGLGHVK
IMIWDHNKERVYDRAKTAFNDQEAAKYIWGICFHWYSGDHFEALSAVHERFPDKKLFFSE
GCQEGGVHLGSWNTGERYGHDIIGNLNNWMSSWTDWNIVLDEQGGPNHVGNFCDAPVIGD
TLKDEVIYESSFYYIGHFSKYIRPGAVRVGSSRYTDKFETTAFRNTDGTYALVVLNRTDS
ELPYTLHFRDQLAEGSIPAHAIQTLLFQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcactacagttcgcgtgatccagacagcccagggaaccggtgaccggttaact
gaattacagcccctgtccttccggccggattccgaagagaaggaaatggagttaattaat
atctatgaggatctggaataccaggagatcgaaggcttcggcggtgcactgacagaagca
tctgcagttacgctggccaagctcagcccggccagacagcaggagattatcgacgcttac
ttccatccggagcatggcatcggctacaccctgtgcagatcacatatccagagctgcgac
ttctcaacaggcaactatgcttatgtagagggtgttgacccggagctggccacgttcaac
atctccagggatcaggagtcgattcttccgttaatcaaacgtgcagctgactccgtgggt
gagagcttccggctgttctcctcgccatggagcccgccggctttcatgaagacgaacggc
gaaatgaataacggcggcaagctgaagccggaataccgggaagcctgggcgaatatgttc
gtgaaatacattcaggcttatgcggaagccggcatcgacatctgggccgtcagtgtgcag
aacgaagccaaagccaagcagatctgggattcctgcatttacaccgctgaggaagagaag
gatttcgtacgtgattatctcggtcctgccctggaagcagccggcttaggccatgtcaaa
atcatgatctgggatcataataaagaacgggtatatgaccgggcgaagaccgctttcaat
gatcaggaggcggcaaaatatatctggggcatctgcttccactggtactccggcgaccac
ttcgaagccctgagcgctgtacatgaacgtttccctgacaagaagctgttcttcagtgaa
ggctgccaggaaggcggcgtacacctcggctcgtggaacacaggcgaacgttacggccat
gacattatcggcaacctgaacaactggatgtccagctggaccgactggaatatcgtcctt
gatgagcagggcggaccgaaccacgtaggcaacttctgcgatgcgccggttatcggcgat
accctgaaggatgaagtaatctatgagagctcattctattacatcggccatttcagcaag
tacatccgtccgggcgccgttcgtgtgggcagctccagatataccgacaaattcgaaact
acggcattccgcaatactgacggcacttatgccttggtcgtacttaaccgcacggacagc
gagctgccatataccctgcacttccgggatcagctggcggaaggctcgattccggcccat
gccatccaaacgctgctgttccaataa

DBGET integrated database retrieval system