KEGG   Paenibacillus borealis: PBOR_19330Help
Entry
PBOR_19330        CDS       T03324                                 

Definition
(GenBank) hypothetical protein
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
pbd  Paenibacillus borealis
Pathway
pbd00860  Porphyrin and chlorophyll metabolism
pbd01100  Metabolic pathways
pbd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PBOR_19330
Enzymes [BR:pbd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     PBOR_19330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Yuri_gagarin HemN_C
Motif
Other DBs
NCBI-ProteinID: AIQ58840
UniProt: A0A089LFH6
Position
complement(4417721..4419091)
Genome map
AA seq 456 aa AA seqDB search
MNQTIQNQLHYLSQKYNEYNLPMYLSYPVDSHWRQPADESAIALELNEIEEAQVYVHIPF
CKSICYYCCCDRVLSGKDEDKDHYIDALEQELSLKLSGRARKLKSGNLHWGGGTPAYLNE
RQIERLYGIITHYVDFEDNARIKLEAYPDKQIVTEGKLRLLKTLGFNYISFGIQDFDPRV
LNAIHRECDLEDTREIIGLARSMGFTVNVDLCYGLLFQGLGEFERTLQEIVRIAPDKIVA
FPYAHYPAIYPLQRKIPHLSLPNNYMVSRLFELARQYLSRDYTEMGSDTFIRNNGREKHP
GTHVVRDFMGSSERSSQQLLGLGKSAVSKIGGLYYKNVAAMDRYHAALELSRLPVETGRT
HRLTGDDALREEVILKQLLGGNPIDKIALQDSFGIDFDSYFQEELIVLRGMEKDGLLLGA
DSPRITVTLTGTYFIRAIAHVFDPYYKSTRNGENSI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcagaccattcagaatcagctgcattatttatcgcaaaagtacaacgaatacaac
cttcccatgtatttaagttatccggtggacagccactggcgccagcctgcagacgagtcc
gctatagctctggagcttaacgaaatcgaagaggcacaggtgtatgtgcatattccgttc
tgcaagtccatctgctactactgctgctgtgaccgggtactgagcggtaaggatgaagac
aaggatcattacattgatgcgctggagcaggagctgtcacttaagctctccggccgtgcc
cggaagctgaaatccggcaatcttcactggggcggggggactccggcttatttaaatgaa
cggcagatcgagcggctgtacggaattataactcattatgtggattttgaagataacgcc
agaataaagctggaggcttacccggacaagcagattgttaccgaaggcaagctgcggctg
ctgaagacactagggtttaactatatcagctttggcattcaggactttgatccccgggtg
ctgaatgccattcaccgggaatgcgatcttgaggatacgcgggaaattatcggccttgcc
cggagcatgggcttcaccgtcaatgtggatttatgctatggcctgctttttcagggactg
ggggaattcgagcgcacattgcaggagatcgtacggatcgcccccgataaaatcgtggct
tttccctatgcccattatccggccatttacccgctgcagcgcaaaatcccgcatctcagc
ctgcctaacaattatatggtgtcccgcctgttcgagctggcccgccagtatttatcccgg
gactacaccgagatgggcagtgatacctttatccgcaacaacgggcgggagaagcatccc
ggaacgcatgtggtccgcgatttcatgggctcctccgagagaagcagccagcaactgctc
ggtctgggcaagtcggcggtcagcaagatcggcgggctctattataagaatgtcgcggcg
atggatcgttaccatgcagcgcttgagctgagcaggcttcctgtcgagaccggcaggacc
catcgtttgaccggagacgatgcccttcgcgaggaggtcattttgaagcagctgctcggc
ggtaacccgattgacaagatagcgctccaggacagcttcggtatcgattttgactcttat
tttcaggaggagctgatcgtgcttaggggcatggagaaggatggcctgctgctgggtgcg
gactctccgcgaattacagtaacccttaccggtacgtactttatccgggctattgcccat
gtttttgatccctactacaaatccaccaggaatggagaaaatagtatatga

DBGET integrated database retrieval system