KEGG   Paenibacillus borealis: PBOR_25200Help
Entry
PBOR_25200        CDS       T03324                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pbd  Paenibacillus borealis
Pathway
pbd00071  Fatty acid degradation
pbd00072  Synthesis and degradation of ketone bodies
pbd00280  Valine, leucine and isoleucine degradation
pbd00310  Lysine degradation
pbd00362  Benzoate degradation
pbd00380  Tryptophan metabolism
pbd00620  Pyruvate metabolism
pbd00630  Glyoxylate and dicarboxylate metabolism
pbd00640  Propanoate metabolism
pbd00650  Butanoate metabolism
pbd00900  Terpenoid backbone biosynthesis
pbd01100  Metabolic pathways
pbd01110  Biosynthesis of secondary metabolites
pbd01120  Microbial metabolism in diverse environments
pbd01130  Biosynthesis of antibiotics
pbd01200  Carbon metabolism
pbd01212  Fatty acid metabolism
pbd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PBOR_25200
   00630 Glyoxylate and dicarboxylate metabolism
    PBOR_25200
   00640 Propanoate metabolism
    PBOR_25200
   00650 Butanoate metabolism
    PBOR_25200
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PBOR_25200
   00072 Synthesis and degradation of ketone bodies
    PBOR_25200
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PBOR_25200
   00310 Lysine degradation
    PBOR_25200
   00380 Tryptophan metabolism
    PBOR_25200
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PBOR_25200
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PBOR_25200
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PBOR_25200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbd04147]
    PBOR_25200
Enzymes [BR:pbd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PBOR_25200
Exosome [BR:pbd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PBOR_25200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C CMD ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIQ59883
UniProt: A0A089LL65
Position
complement(5634161..5635351)
Genome map
AA seq 396 aa AA seqDB search
MNTAKEIVIVSAVRTALGTFGGSLAGISAVDLGALVIKEALRRAGVTPDQVDEVIMGNVL
QGGLGQNPARQAAVKAGIPVEASSLTINKVCGSGMKAVHLAAQSIMAGDSEIVVAGGMEN
MSKAPYVLDQARYGYRMGNGTLIDTMVNDGLTCAFNHYHMGITAENVSEQFGISREMQDA
LAASSQEKAVRAIEAGHFKEEIVPVIIPQRKGEAIIFDTDEFPRKGTTAGKLAALRPAFK
QDGSVTAGNASGINDGAAALVIMSAEKAAALGLKPLARILSYASGGVDPSIMGMGPVPAT
KKALQRGGLTIGDIDLIEANEAFAAQMLAVGQALDFPEEKVNVNGGAIALGHPIGASGAR
ILVTLVHALKQRGARTGLATLCIGGGHGVTTIIERI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagccaaagaaattgtcattgtcagcgcagtgcggacggcactcggcaccttt
ggcggaagtctggccgggatttccgctgtagatttgggggcgctggtcatcaaggaggcg
ctgcggcgggcgggcgtcacaccggaccaggttgacgaagtgattatgggcaacgtgctt
cagggcgggctgggccagaatccggcgcggcaggcggcggttaaggcgggcattccggtt
gaggcatccagcttgaccattaacaaggtgtgcggttcgggcatgaaggcggtccatctg
gctgcgcagagtattatggcaggagacagcgagattgttgtagccggcgggatggagaat
atgtcgaaggcgccttatgtgctggatcaggcccgctacggctaccgcatgggcaacggg
acactgatcgatacgatggtgaatgacgggttgacctgcgcattcaaccattaccatatg
ggcatcacggcggaaaatgtctccgaacaattcgggatcagccgggaaatgcaggatgcc
ctggcggcgtccagccaggagaaggccgtgcgcgccattgaagcaggccatttcaaggaa
gaaatcgtacctgtcatcattccgcagcgaaaaggcgaggccattatcttcgataccgat
gagttcccgcggaaaggaacgaccgccgggaagctggcagctctccgcccggcctttaag
caggacggcagtgtgactgccgggaacgcctcgggcattaatgacggcgctgcggcgctg
gtcattatgtcggcggagaaagctgctgcgcttgggctgaagccgcttgcgcgcatcctg
tcctacgcgtccggcggtgtggatccctccatcatggggatgggtccggttccggcaacg
aagaaggcgctgcagcgtggcggcctgacgatcggcgacatcgatctcatcgaggctaac
gaggcctttgcggcgcagatgctggcggtaggccaggccctggacttcccggaggagaag
gtcaatgtgaacggcggggccatcgccctgggtcatccgatcggtgcgagcggggcaaga
attctcgtaacactggtacatgcactgaagcagcgcggtgcccgcaccggacttgccacg
ctctgcatcggcggagggcatggcgtaacgacgattattgagcggatctag

DBGET integrated database retrieval system