KEGG   Paenibacillus borealis: PBOR_29730Help
Entry
PBOR_29730        CDS       T03324                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pbd  Paenibacillus borealis
Pathway
pbd00564  Glycerophospholipid metabolism
pbd01100  Metabolic pathways
pbd01110  Biosynthesis of secondary metabolites
Module
pbd_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pbd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PBOR_29730
Enzymes [BR:pbd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     PBOR_29730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF3422 zf-XS
Motif
Other DBs
NCBI-ProteinID: AIQ60654
UniProt: A0A089MW48
Position
6748296..6749087
Genome map
AA seq 263 aa AA seqDB search
MVKQLLRLMTELSSHRWLSRVMGAFSHSRLSRFMIPVFIRSYHIPAAEAEKTAGEYRTLN
EFFSRRLKPGMRPVASGEQAVASPVDAMITAMGDINCGTIMNVKGQDYTLEDLLNHSPHL
ELYKKGYYFVLYLSPTDYHRIHSPLTGQLRESDYIRGRAYPVNDFGMRHMKSVLSRNERL
ITYIAGSYGETAVVKVGAMNVSSIRYTDENATEWQRGDDLAYFEFGSTVVLLLESGTFTP
RPGLTVDTKVKMGELLGEMQRAT
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggttaaacaattgctgcggctgatgaccgagctatcctcacacagatggctttcccgg
gtaatgggtgctttttcccatagcagactcagccgctttatgattccggtatttattcgt
tcctatcatattcctgccgctgaggcggagaagactgccggagaataccgtacacttaat
gaattcttcagcagacgcctgaagccgggaatgcggccggtcgcaagcggtgaacaggcg
gtggcaagtcctgtggacgccatgattacggcaatgggcgacattaactgcggaacaata
atgaatgtgaagggtcaggattatacgctggaggatttgcttaatcattcgccacacctc
gaattgtataaaaaaggctactatttcgttctttacctgagccccaccgattatcaccgg
atacattccccgttaaccgggcagctgcgggagagcgattatatccgcggccgggcttat
cccgtgaatgatttcggcatgcggcatatgaagagtgtcctgagccgcaacgaacggctg
attacttatatagccggcagctatggcgaaaccgccgtggtcaaggtaggcgcaatgaat
gtgagcagtatccgctacaccgatgagaacgccacagaatggcaaagaggcgacgatctg
gcctatttcgaattcggttctaccgtagtcctgctgctggagagcggcaccttcacaccg
cgccccgggcttaccgtggacacgaaggtgaagatgggcgagctgctgggtgagatgcag
cgcgctacttag

DBGET integrated database retrieval system