KEGG   Paenibacillus borealis: PBOR_34045Help
Entry
PBOR_34045        CDS       T03324                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pbd  Paenibacillus borealis
Pathway
pbd00480  Glutathione metabolism
pbd00590  Arachidonic acid metabolism
pbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PBOR_34045
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PBOR_34045
Enzymes [BR:pbd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PBOR_34045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AIQ61369
UniProt: A0A089MYA1
Position
complement(7693467..7693946)
Genome map
AA seq 159 aa AA seqDB search
MSIYSFAGVTPSGTEVPFKNYEGKVLLIANTASKCGLTPQYGDLQKLYEQYGDQGLVVLG
FPCNQFAGQEPGTSEEAEAFCQINYGVTFPVFAKVDVNGPEASLLFQYLKGQQPGDGESS
DIQWNFTKFLVDRSGNVVARVEPKESPESMKDLIESLLK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatctatagttttgccggagtcacaccttcgggtacagaagtgccgtttaagaac
tatgagggcaaggtgctgctgatcgccaatacggccagcaaatgcgggcttaccccgcaa
tacggagatttgcagaagctgtacgaacagtacggagatcaagggctggtagtgctggga
ttcccctgcaaccagtttgccggccaggagccgggtacaagtgaggaagcggaagccttc
tgccagatcaattacggggttactttcccggtgtttgccaaggtagatgttaatgggccg
gaggcaagcctgctctttcaatatttgaagggccagcagccgggtgacggggagagcagc
gatatccagtggaactttacgaagtttcttgtagaccgcagcggcaatgtggtggcgcgt
gtggagccgaaggaatcaccggagagcatgaaggaccttatcgaatccctgctgaagtaa

DBGET integrated database retrieval system