KEGG   Plasmodium berghei: PBANKA_041480Help
Entry
PBANKA_041480     CDS       T01111                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pbe  Plasmodium berghei
Pathway
pbe00220  Arginine biosynthesis
pbe00330  Arginine and proline metabolism
pbe01100  Metabolic pathways
pbe01110  Biosynthesis of secondary metabolites
pbe01130  Biosynthesis of antibiotics
pbe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PBANKA_041480
   00330 Arginine and proline metabolism
    PBANKA_041480
Enzymes [BR:pbe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PBANKA_041480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 3424964
NCBI-ProteinID: XP_676460
Position
4
AA seq 354 aa AA seqDB search
MYECIQDYLTNHKDEKNIYVNKCISIVGSPLSAGQSLSGVNKACDNLRKFGLHDVIKAVG
WGYEDIGNIGEKIPINGFLKQENIEKENDQINNNNPSYYNNIKNAEVIGKFSEKLFQTMS
SELKKKNFILNIGGDHGVAFSSILSMLQTYNNLKVIWIDAHGDINIPETSPSGNYHGMSL
AHALGLFKKKVPYFEWSEKLLHLKPENVAIIGIRDIDKYEKIILKKCNINYYTMFDIDKK
GIYNIICEALNKIDPNKNSPIHISLDIDSVDSIYAPGTGTIAKGGLNYREIHLLIKSISD
TKRVVSMDIVEYNPLLDESDKAVHGDSLPIDPNATKTGKLCLELIARVLGNDIV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatgcattcaggattatttaacaaatcataaagatgaaaagaacatttatgtt
aacaaatgtatatcaatagttggctccccattatctgctggtcaatcccttagcggtgta
aataaggcttgtgataatttgagaaaattcggattacatgatgttattaaagcagtaggc
tgggggtatgaagatattggaaatattggagaaaaaataccaatcaatggttttttaaaa
caagaaaatattgaaaaggaaaatgaccaaataaataacaataatccaagctactataat
aatataaaaaacgcagaagttatcggtaaatttagtgaaaaattattccaaaccatgagt
tcagaattaaaaaaaaaaaattttattttaaatattggaggcgatcatggggttgctttt
tcaagcatattaagcatgttgcaaacatataataatttaaaggttatatggatagatgca
catggggatataaatatacccgaaacgtcaccttctggaaattatcatggaatgtcatta
gcacatgctttaggcttgtttaaaaaaaaagttccatattttgaatggtcagaaaaatta
ttacatttaaaaccagaaaatgtagctattattggaataagagatatagataaatatgaa
aaaattattttaaaaaaatgtaatataaattactatactatgtttgatatagataaaaaa
ggtatttacaatattatttgtgaagctttaaataaaatcgatccaaataaaaattcccct
atacatatatcactggatattgatagtgttgattcgatatacgcgcctggaactggtaca
atagctaaaggtggattgaattatagggaaattcatttattaatcaaatctatatcagat
actaaacgagttgtatctatggacattgttgaatataacccccttttggatgaaagtgat
aaagctgtgcatggagattctttaccaattgatccaaatgctacaaaaactggaaaatta
tgtcttgagcttattgccagagttctaggcaatgatatagtttaa

DBGET integrated database retrieval system