KEGG   Plasmodium berghei: PBANKA_050500Help
Entry
PBANKA_050500     CDS       T01111                                 

Definition
(RefSeq) dihydrolipoamide acyltransferase, putative
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pbe  Plasmodium berghei
Pathway
pbe00010  Glycolysis / Gluconeogenesis
pbe00020  Citrate cycle (TCA cycle)
pbe00620  Pyruvate metabolism
pbe01100  Metabolic pathways
pbe01110  Biosynthesis of secondary metabolites
pbe01130  Biosynthesis of antibiotics
pbe01200  Carbon metabolism
Module
pbe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PBANKA_050500
   00020 Citrate cycle (TCA cycle)
    PBANKA_050500
   00620 Pyruvate metabolism
    PBANKA_050500
Enzymes [BR:pbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PBANKA_050500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-GeneID: 3426928
NCBI-ProteinID: XP_022712253
Position
5
AA seq 624 aa AA seqDB search
MMRYFIFFLTFWLNIYKCINIKIRNNYGFINLNNNLRILHKNKHVLYSKVEIKMPALSST
MTSGKIVRWNKTVGEFINVGDIIMTVESDKADMDVESFDEGYLRRKIIEEGSEANVGDVL
GILTTEENEEVENVDSVKEGTINDETIKEGTINEKATQEGTIDEEAIKEEGVEKDIYIPS
VQSKRNKVRISKWLCKENEFVNKYDVIFHIEDDKSTVEVDSPYTGTIKTILVKEGELADL
EKEVAIILVKKEPNELDTPPINLNSKIKERDVITHFKKKIKDTKEGKQFLKTLNYDTEKI
LEERLKLNSDKYYQDIHNNFRSSELDPKSIKGGIQNNQEHGQLHEKIVLPSAIELMKKHK
LTPEDITYTSIPNRITYEDVDIFLEKKKKIPKIETGPTVETDTRVVKLTNIQKSIKNNMM
LTLNVPVFRITHLMKTSQLIKIYEQVKDKISMSVILNKCVSLALLKNPLIYSTYIDNENG
EIRYNKSVNIGNALGLIDCLLTPVLKNVDQKDIYTLSTEWKDLIKKGKSGTLSANEMSGG
NFFISNLGMFNTYQFDAILPKNVSCILSIGTNIVSINQFDDLKINKGIMMTLTCDHRHIY
GSHAATFMNDLANIIENNIMDIFL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgatattttattttttttcttacattttggttaaatatttataaatgtattaac
attaaaattagaaataattatggatttataaacttaaataataatttgagaatacttcac
aaaaataaacatgtcctttattcgaaagttgaaataaaaatgcctgccctatctagtact
atgacgagtggcaaaattgttcgctggaataaaactgttggagaatttatcaatgttgga
gatataattatgacagtagaaagtgataaagcagacatggatgttgaatcgtttgatgaa
ggatatttaagaaggaaaataatcgaagaagggtctgaggcaaatgttggagatgtacta
ggaattctaacgactgaagaaaatgaagaagtggaaaatgtagattcggtaaaagaagga
acaataaatgacgaaactataaaagaaggaacaataaatgaaaaagctacacaagaagga
acaatagatgaagaagcgataaaagaagaaggcgtggaaaaagatatatacattccatca
gtgcaaagtaaaagaaataaagtaagaatttccaaatggttatgtaaagaaaacgagttt
gtgaataaatatgatgttatatttcacattgaggacgacaaaagtacagttgaagtggat
agcccttatacaggtacaataaaaacaattttagtgaaagaaggagaacttgcagatttg
gaaaaagaagttgccataattttagttaaaaaggaaccaaatgaactggacaccccccct
ataaatttaaatagcaaaataaaagagcgtgatgtaataacacattttaaaaaaaaaata
aaagacactaaagaagggaaacaatttttaaaaacattaaattatgatactgaaaagata
cttgaggagaggctcaaattaaatagcgataaatattatcaagatattcacaacaatttt
agatcttctgaattggacccaaaaagcatcaaggggggtatacagaacaaccaagaacat
ggacaattgcatgaaaaaatagtattgccatctgccattgaacttatgaagaagcataaa
ctaactcccgaagatatcacatacacgagcataccgaacagaatcacttacgaagatgtc
gacatatttctcgaaaaaaaaaaaaaaattccaaaaatagaaactggtccaacagtagaa
accgatacaagagtggtaaaactaacgaatatacaaaagtctataaaaaataatatgatg
ctaacattaaacgttccagtatttcgaataacacatttaatgaaaacttctcaattaata
aaaatatatgaacaagtaaaagataaaataagtatgtcagtcatattaaataaatgtgta
tctttggctttacttaaaaatccattaatatattcaacatatatagataatgaaaatgga
gaaattcgatataataaaagtgtaaatataggaaacgcattagggctcattgactgttta
ttaacgcctgttttaaaaaatgtcgatcaaaaagatatatatacattgtcaacagaatgg
aaagatctgataaaaaaaggaaaaagtggaaccctttcagcaaatgaaatgtctggaggt
aatttttttatttcgaatttaggaatgtttaacacatatcagtttgatgctattttgcca
aaaaacgtatcatgtattttatcaattggtacaaatatagttagtataaatcagtttgac
gatttaaaaataaataaaggaataatgatgactttaacatgtgatcatagacatatatat
ggttcccatgctgctacatttatgaatgatttagcaaatatcattgaaaataatatcatg
gatatatttttataa

DBGET integrated database retrieval system