KEGG   Plasmodium berghei: PBANKA_061050Help
Entry
PBANKA_061050     CDS       T01111                                 

Definition
(RefSeq) glutathione peroxidase-like thioredoxin peroxidase, putative
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pbe  Plasmodium berghei
Pathway
pbe00480  Glutathione metabolism
pbe00590  Arachidonic acid metabolism
pbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PBANKA_061050
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PBANKA_061050
Enzymes [BR:pbe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PBANKA_061050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 3421755
NCBI-ProteinID: XP_673343
UniProt: A0A509AJ28
Position
6
AA seq 200 aa AA seqDB search
MRILLILKLSILFLFARENFITMFSYFKKITVIKSDLKPSIYDYNVKSLDGINIPMSTYK
NKVLIIFNSASKCGLTKNHINQFNTLYEKFNHKGLEILGFPTYQFFNQEYKQSCDISQFN
QEKNIKYHVFAPIEVNGTNTHELFKYLKFNCNEMHDENGVLDNIGWNFGKFLIDRYGNVV
KYFSPKISPSNMEKYITDLL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatattattaatacttaaattaagtatattatttttatttgcccgtgaaaatttt
atcacaatgttttcctattttaaaaaaataactgtaataaaaagtgatttgaagccttct
atatatgactataatgtgaaatcgttagatggaataaatatacctatgtcaacatataag
aacaaagttttgattatttttaattccgcatcaaagtgtggtttaacaaaaaatcatatt
aaccagtttaatacattatatgaaaagttcaatcataaaggattagagatcctaggattt
cctacgtatcagttttttaaccaagaatataaacaaagttgtgatatcagtcaatttaat
caagaaaaaaacataaaatatcatgtattcgctcctattgaagtaaatggaacaaatacc
cacgaactttttaaataccttaagtttaactgtaatgagatgcatgatgaaaatggcgta
ttagataacattggatggaattttggaaaatttttaatagatagatatggaaatgtagtt
aaatatttttcgccaaaaattagcccatcaaacatggaaaaatatattaccgatttatta
taa

DBGET integrated database retrieval system