KEGG   Plasmodium berghei: PBANKA_121280Help
Entry
PBANKA_121280     CDS       T01111                                 

Definition
(RefSeq) MO15-related protein kinase
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
pbe  Plasmodium berghei
Pathway
pbe03022  Basal transcription factors
pbe03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pbe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    PBANKA_121280
  09124 Replication and repair
   03420 Nucleotide excision repair
    PBANKA_121280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbe01001]
    PBANKA_121280
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pbe03021]
    PBANKA_121280
   03019 Messenger RNA biogenesis [BR:pbe03019]
    PBANKA_121280
   03400 DNA repair and recombination proteins [BR:pbe03400]
    PBANKA_121280
Enzymes [BR:pbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     PBANKA_121280
    2.7.11.23  [RNA-polymerase]-subunit kinase
     PBANKA_121280
Protein kinases [BR:pbe01001]
 Serine/threonine kinases: CMGC group
  CDK family
   PBANKA_121280
Transcription machinery [BR:pbe03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PBANKA_121280
Messenger RNA biogenesis [BR:pbe03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Capping factors
     PBANKA_121280
DNA repair and recombination proteins [BR:pbe03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     PBANKA_121280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo Pkinase_fungal BTD APH
Motif
Other DBs
NCBI-GeneID: 3422498
NCBI-ProteinID: XP_674066
UniProt: A0A077XEG1
Position
12
AA seq 324 aa AA seqDB search
MEHNSNERYIFKPNFLGEGSYGKVYKAYDTVLKKEVAIKKMKLNKISNYIDECGINFLIL
REIKIMKEIKHKNVMNALDLYCEKDYINLVMEIMDYDLAKLINRKILLTDSQKKCILLQI
LNGLNTLHKYYFMHRDLSPANIFINKKGEVKIADFGLSSKYAFDMHSGKMANDKYSKRAL
NLTSKVVTLWYRAPELLMGSNKYNSSIDMWSFGCIFAELLLQKALFPGENEIDQLGKIFF
LLGTPNENNWPEAKHLPLYTDFTKSNKKNLKNIIKIEDDDCIDLLTSLLKLNSHERITAE
EALKHRYFLNDPLPCDASQLFIDM
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaacataattcaaatgaaagatacatatttaaaccaaattttttgggggagggttcg
tatggtaaggtatacaaagcttatgataccgtgttaaaaaaggaagttgctattaaaaaa
atgaaactaaataagattagcaattatatagacgagtgtggtataaattttttaatatta
agggagataaaaataatgaaagaaataaaacataaaaatgtaatgaatgctttagattta
tattgtgaaaaggattatataaacttagttatggaaataatggattatgatttagctaaa
ctaattaatcgtaaaatattattaacagatagccaaaaaaaatgtattcttttacaaatt
ttaaatggcttaaatactttgcataaatactattttatgcatagagatttatcaccagca
aatatttttataaataaaaaaggggaagttaaaattgctgactttggtttatcttctaag
tatgcatttgacatgcattcaggtaaaatggcaaatgataaatatagtaaaagagcttta
aacttaacaagtaaggttgttacattatggtatagagcccccgaattattaatggggagt
aataaatataattcatcaattgatatgtggagctttggctgtatttttgctgaactttta
ttacaaaaggcattattccctggagaaaatgaaatagatcaattgggaaaaatatttttc
ctcttaggcacaccaaatgagaataattggcctgaagcaaaacaccttcctttatatact
gattttacaaaatcgaataaaaaaaatttaaaaaacattattaaaattgaagatgatgat
tgtattgatttattaacttcattattgaaattaaattcacatgaacgtattactgcagag
gaagcgttaaaacatcgttattttttaaacgaccccttaccatgtgatgcttcacaactt
ttcattgatatgtaa

DBGET integrated database retrieval system