KEGG   Plasmodium berghei: PBANKA_123990Help
Entry
PBANKA_123990     CDS       T01111                                 

Definition
(RefSeq) acyl-CoA synthetase, putative
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pbe  Plasmodium berghei
Pathway
pbe00061  Fatty acid biosynthesis
pbe00071  Fatty acid degradation
pbe01100  Metabolic pathways
pbe01212  Fatty acid metabolism
pbe04146  Peroxisome
Module
pbe_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pbe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PBANKA_123990
   00071 Fatty acid degradation
    PBANKA_123990
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PBANKA_123990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pbe01004]
    PBANKA_123990
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbe04147]
    PBANKA_123990
Enzymes [BR:pbe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     PBANKA_123990
Lipid biosynthesis proteins [BR:pbe01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   PBANKA_123990
Exosome [BR:pbe04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   PBANKA_123990
  Exosomal proteins of breast cancer cells
   PBANKA_123990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 3426662
NCBI-ProteinID: XP_678095
UniProt: A0A077XF86
Position
12
AA seq 674 aa AA seqDB search
MFTTTGKLIYAVEHTPSTSKDSTAVYRNPKFNDKLLDNFEDNPLNNLWDMFNKSAEKYKN
RHCFGTRIRKNDKLGEYKWKTFKEVQELIILIGSGLMNKNICPLIECNDTKIPRARFLGL
YLPNCEEWNICDFSCNAFNIITVPLYDSLGIESSKFILDQTMMQTIMCNKTCGLKLIKSL
DKFDHIYIKTLILVEKEIDPEIESTCNKLNIKIVTWDDLIEAGKKKKLDPKPGKLSDVSS
ICYTSGTTGYPKGVIMTNQNFIAQIASSCLGPSKFPMLNINEKDTHLSYLPLAHVYERIM
MCLFLYLGIRVGYYSGNILALTDDIQELKPTLFLSVPRLYNRIHERICNSLKKKSSVVQS
LFHKGLDHKIKKLNNTGNPWSLFWDTLLFNKAKKILGGNLRGMLNGSAPLGVEVAKKLKC
IFCVPLMEGFGMTEGLGCLFITNPIDPDVGHIGGPLPSVEYKLVSVPEMNYLVTDNPPRG
ELLLRGPTICNLGYFKLEKETNELLDSDGWMKTGDIASFSQNQSITIIDRKKNIFKLSQG
EYVAVEKIESVYKQSLFIAQIFVFGYSYESFLVCIVFPSVDTMRIWAKENKINKSNEEII
KLEKFKNDVMKDLIKIGKTDGLNGYEQIKDIHFIMEGFTIENDLMTPTGKIKRHAVQNKF
KQEIDKMYENVKKA
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgtttaccacaacgggtaagcttatttacgctgttgagcataccccgtccacgagtaag
gactcgactgcggtttacagaaatccaaaattcaatgataagttgttggataattttgag
gataatccattaaataatttatgggatatgtttaataaatcagctgagaaatataaaaat
agacattgctttggtacaagaattcgtaaaaatgataaattaggtgaatataaatggaaa
acatttaaagaagtacaggaattgataatattaatcggttctggtttaatgaataagaat
atatgcccattaattgaatgtaatgatacaaaaattccacgagcacgatttttaggttta
tatttacctaactgtgaagaatggaacatttgtgattttagttgtaatgcatttaatatc
attacagtaccattatatgattcattaggtatagaatcaagtaaatttatattagatcaa
acaatgatgcaaacaattatgtgtaataaaacatgtggcttgaaattaataaaatcttta
gataaatttgatcatatatatataaaaacattaatattagtagaaaaagaaatagatcca
gaaatagaaagcacatgcaacaaattaaatataaaaatagtaacatgggatgatttaata
gaagcaggaaaaaaaaaaaaattagatcctaaaccaggaaaattaagtgatgtttcttca
atatgttatacatctggtactactggatatcctaagggagttataatgactaaccagaat
tttattgcacaaattgcttcatcttgtttggggccatccaaatttcctatgcttaatata
aatgaaaaagatacccacttatcttatcttccattagcacatgtttatgaaagaattatg
atgtgtttatttctatatttaggaataagggttggatattattcaggaaatatattagcc
ttaactgatgatattcaagaattaaagccaacgttatttcttagtgtacctagattatat
aatagaatacatgaaagaatatgtaattcattaaaaaaaaaatcatctgtggtccaatca
ttatttcataagggactagaccataaaattaaaaaattaaataatacaggaaatccttgg
agtcttttttgggatacattattatttaataaagcaaaaaaaatattaggtggaaattta
agaggaatgttaaatggttctgctccacttggtgtagaagtagcgaaaaaattaaaatgt
atattttgtgtaccattaatggaaggatttggtatgactgaagggttgggctgtttattt
attacaaatcctattgatccagatgtggggcatattggtggcccattaccatctgttgaa
tataaattagtttctgtacctgaaatgaattatttagttacagataatccaccacgaggt
gaattacttttaagaggcccaactatatgtaatttaggatattttaaattagaaaaagaa
acgaatgaattattggatagtgatggatggatgaaaacaggagatattgcatcttttagt
caaaatcaatcaataactattattgatagaaaaaaaaatatatttaaattatcacaaggt
gaatatgtagctgtagaaaaaatagaatctgtttataaacaatcattatttattgcacaa
atatttgtttttggatattcttatgaatcatttttagtttgtattgtttttccatcggtt
gatacgatgcgtatatgggcaaaggaaaacaaaataaataaatcaaatgaagaaattata
aaattagaaaaattcaaaaatgatgttatgaaagatttaattaaaataggtaaaactgat
ggattaaatggatatgaacaaattaaagatattcattttattatggagggatttactatt
gagaatgatttgatgacgccaactggaaaaataaaaaggcacgctgtacagaataaattc
aaacaagaaattgacaaaatgtatgaaaatgtaaaaaaggcatga

DBGET integrated database retrieval system