KEGG   Plasmodium berghei: PBANKA_145010Help
Entry
PBANKA_145010     CDS       T01111                                 

Definition
(RefSeq) mRNA methyltransferase, putative
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
pbe  Plasmodium berghei
Brite
KEGG Orthology (KO) [BR:pbe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pbe03019]
    PBANKA_145010
Enzymes [BR:pbe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     PBANKA_145010
Messenger RNA biogenesis [BR:pbe03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     PBANKA_145010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 DUF43 DUF5125
Motif
Other DBs
NCBI-GeneID: 3427379
NCBI-ProteinID: XP_022714103
Position
14
AA seq 660 aa AA seqDB search
MNNNQINSNNNKNMGTQNFNQNFTNNTVNNKQPNNTSYQYANINYKKTNSPPIMNYNNNP
NFVNTNYSNYNNIAPPPSGIPPNNIPINNKNIYYIPQNPTNIPSPPSPPNIPSSPNMDYG
NNTNLKNPVSEGMNIENDDLLGQDYGKTTHYNSNYMGNNTNMFGTHVNNKYPDQVPPPSV
PPPNTGDIYQYNNTNNAHNIHMKSGGNLPNANNISGMFNMQNNGSIMGFHGEYSNNIINM
NSDQTMITNNSNNFIRDMKSYDYPFNDNIAPPPLPNPNQIHPDNKFYNNNDNNINIKNLE
NMNSIRNSSNTNLKKNEYKNNSCNINVDGRERLQNDYNQNFVNTGERPQNFIRDSDENKR
FIKYPKLKQLLELKNAIIKKRSTPARYIKCDLRNFDLSSLDMKFDVILIDPPWKEYYDRK
IQNLDLLNSIHIDNYDINDDIYNDKDKYWSLEDLSNLKIEQIAEVPSFLFIWCGVTHLED
ARVLLNKWGYRRCEDICWLKTNINEKNKKIKYLNEINNENSYLQRTTEHCLVGIKGAVRR
SYDVHLIHANLDTDVIIAEETEENIYNNNKPEELYKIIEKFCLGRRKIELFGTNTNIRNG
WLTLGKNINGTLFEQEEYTSWFEGDIAWPEATSYIGGKYMGTTPEIENLRPKSPPRNVNP
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaatcaaataaattcaaataacaataaaaatatggggacacaaaattttaat
caaaattttacaaataatactgtaaataataaacaacccaataatacatcgtatcagtat
gcaaatataaattacaaaaaaacaaatagtcccccaataatgaactataataataacccc
aattttgtaaatacaaattattctaattataataacattgcacccccacctagtggtatt
ccaccaaataacattcccataaacaataagaatatttattacattcctcaaaatcctact
aatattccaagcccccccagccctccaaacatacccagttcaccaaatatggactatgga
aataatacaaatttaaaaaatcctgtatctgaaggaatgaatatcgaaaatgatgatttg
ttaggacaagactatggtaaaactacccattataattccaattatatgggaaacaatact
aatatgttcggaacccatgttaataataaatatcctgaccaagtgcccccaccaagtgta
ccccctccaaacacaggggatatataccaatataataacacaaacaatgcacataatata
cacatgaaaagtgggggtaatttacctaatgccaacaacataagcggaatgttcaacatg
caaaacaatggatctataatgggatttcatggagaatattctaacaatataattaatatg
aactctgatcaaactatgataacaaataattcaaacaattttataagagatatgaaaagt
tatgattatccatttaatgataatatagctccacctccacttcctaatccaaatcaaata
cacccagataacaaattttataataataacgataataatataaatattaagaatttagaa
aatatgaatagtattagaaattcatcaaatactaacttaaaaaaaaatgaatataaaaat
aatagttgtaatataaatgtagatggtcgagaaagactgcaaaatgattataatcaaaat
tttgtaaacacaggtgaaagacctcaaaattttattagagatagtgatgaaaataaaaga
tttattaaatatcctaaattaaaacaactattagaattaaaaaatgcaataataaaaaaa
agatcaacaccagctagatatataaaatgtgatttacgaaattttgatttatctagttta
gatatgaaatttgatgttatattaattgatcctccttggaaagaatattatgatagaaaa
atacaaaatttggatttgttaaatagtatacatatagataattatgatataaatgatgat
atatataatgataaagataagtattggtctttagaggatttatcaaatttaaaaatagag
caaatagcagaagttccatcctttctttttatatggtgtggcgtaacacatttagaagat
gctagagttttattaaataaatggggatatcgtagatgtgaagatatatgctggttaaaa
actaacattaatgaaaaaaacaaaaaaattaaatatctaaatgaaataaataatgaaaac
tcatatttacagagaaccactgagcattgtttagtaggaattaaaggtgcagttagacgg
tcttatgatgtacatttaatacatgcaaatttagatacagatgttattattgcagaagaa
actgaagaaaatatatataataataataaaccagaagagttatataaaattatcgaaaaa
ttctgtttaggacgaaggaaaatcgaactttttggaacaaatacaaatataagaaatgga
tggttaacattaggaaaaaatattaatggtacattatttgagcaagaagaatatacaagt
tggtttgaaggtgacattgcttggcccgaagcaacttcatatataggaggaaagtatatg
ggaacaactccagaaatcgaaaatctacgtccaaaatcgccgccgagaaatgttaaccct
tga

DBGET integrated database retrieval system