KEGG   Polyangium brachysporum: AAW51_3861Help
Entry
AAW51_3861        CDS       T04216                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pbh  Polyangium brachysporum
Pathway
pbh00071  Fatty acid degradation
pbh00072  Synthesis and degradation of ketone bodies
pbh00280  Valine, leucine and isoleucine degradation
pbh00310  Lysine degradation
pbh00362  Benzoate degradation
pbh00380  Tryptophan metabolism
pbh00620  Pyruvate metabolism
pbh00630  Glyoxylate and dicarboxylate metabolism
pbh00640  Propanoate metabolism
pbh00650  Butanoate metabolism
pbh00900  Terpenoid backbone biosynthesis
pbh01100  Metabolic pathways
pbh01110  Biosynthesis of secondary metabolites
pbh01120  Microbial metabolism in diverse environments
pbh01130  Biosynthesis of antibiotics
pbh01200  Carbon metabolism
pbh01212  Fatty acid metabolism
pbh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAW51_3861
   00630 Glyoxylate and dicarboxylate metabolism
    AAW51_3861
   00640 Propanoate metabolism
    AAW51_3861
   00650 Butanoate metabolism
    AAW51_3861
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AAW51_3861
   00072 Synthesis and degradation of ketone bodies
    AAW51_3861
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AAW51_3861
   00310 Lysine degradation
    AAW51_3861
   00380 Tryptophan metabolism
    AAW51_3861
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AAW51_3861
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AAW51_3861
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AAW51_3861
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbh04147]
    AAW51_3861
Enzymes [BR:pbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AAW51_3861
Exosome [BR:pbh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AAW51_3861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AKJ30552
UniProt: A0A0G3BMB6
Position
4585259..4586470
Genome map
AA seq 403 aa AA seqDB search
MTTMLNAYLYDGLRSPFGRHGGALAAVRPDDLVAEVMRALVARSPWQAEQIEDVILGNTT
QAGEDSRNIARNALLAAGFPVSVPGQTVNRLCASGLAAVIDAARAITCGDGDLYLAGGVE
SMSRAPFVVGKSESAYSRDFKVFDTTIGARFPNPKVTAKYGGDTMPETGDNVAKQFGITR
EQADRFAAASQAKFERARADGFFAGEIHTIEVPTGRKTPPIAVSEDEHPRPESTYETLAK
LKPLFEGGVVTAGNASGINDGAAALLVGSLAAGEKAGRKPMVRILSAAAAGVEPRIMGVG
PVPAIQKALQRAQLTLGDMDIIEINEAFASQVLGCLHLLEVPFDDTRVNPNGGAIAVGHP
LGASGARLALSTARELQRRQGRYAVVSLCIGVGQGLAMVIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatgttgaatgcctatctctacgacggcctgcgttcgcctttcgggcgccac
ggcggtgccctggccgcggtgcggcccgatgacctggtggccgaggtgatgcgcgccctg
gtggcccgctccccctggcaggccgagcagatcgaggacgtcatcctcggcaacaccacg
caagcgggtgaagactcgcgcaacatcgcccgcaacgccctgctggccgccggtttcccg
gtcagcgtgccggggcagaccgtcaaccgcctctgcgccagcgggctggcggcggtgatc
gacgccgcacgcgcgatcacctgcggtgacggcgacctctacctggccggtggcgtcgaa
agcatgagccgcgcgcccttcgtcgtgggcaagagcgaaagcgcctacagccgcgacttc
aaggtgttcgacaccaccatcggcgcccgcttccccaacccgaaggtcaccgcgaaatac
ggcggcgacacgatgcccgagaccggcgacaacgtggccaagcagttcggcatcacacgt
gagcaggccgaccgcttcgccgcggcatcgcaagccaagttcgaacgcgcccgtgccgac
ggcttcttcgccggcgagatccacaccatcgaggtgccgaccggccgcaagacgccgccg
atcgcggtcagcgaagacgagcatccgcgtcccgaatcgacctacgagacgctggccaag
ctcaagcccctgttcgaaggcggtgtcgtcacggccggcaatgcctcgggcatcaacgac
ggtgccgcagcgctgctggtcggcagcctggcggccggcgagaaggccggccgcaagccg
atggtgcgcatcctgagcgccgccgccgccggtgtcgagcctcgcatcatgggcgtcggc
ccggtgccggcgatccagaaggcactgcaacgagcgcagctgaccctgggcgacatggac
atcatcgagatcaacgaagccttcgcgagccaggtgctgggttgcttgcacctgctcgaa
gtgcccttcgacgatacacgcgtcaatcccaacggcggcgccattgcggtgggccatccg
ctcggcgcatcgggcgcccgcctggctctcagcaccgcgcgcgagctgcagcgccgccag
ggccgctatgccgtggtcagcctgtgcatcggcgtcggccaaggcctggcgatggtcatc
gagcgagtttga

DBGET integrated database retrieval system