KEGG   Polyangium brachysporum: AAW51_4751Help
Entry
AAW51_4751        CDS       T04216                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
pbh  Polyangium brachysporum
Pathway
pbh00360  Phenylalanine metabolism
pbh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pbh00790  Folate biosynthesis
pbh01100  Metabolic pathways
pbh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AAW51_4751 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AAW51_4751 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AAW51_4751 (phhA)
Enzymes [BR:pbh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     AAW51_4751 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AKJ31442
UniProt: A0A0G3BPV2
Position
5577980..5578882
Genome map
AA seq 300 aa AA seqDB search
MQQDAWTDETPRAVNQGVAPVTYGQGDRPPRGDYARARADYTCEQDWAAYSEAEHALYRR
LYERQAAQLPGLACEEFIEAVQHLGAPEQIPRFDSLSEQLHRTTGWEVVAVPGLIPEEAF
FKLLSQRRFPVTQWIRRPDEFDYVVEPDLFHDLFGHVPLLFNPVFADYMQAYGAGGLKAS
GLNACELLARLYWYTVEFGLIATPQGVRAYGAGILSSAGELPHSVRVAQPKHVPFDLLRV
MRTRYKIDAYQETYFVIDSFQQLFEATAPDFAPLYEQVRGLPEIEAGVVLPHEAPPRVLA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggacgcttggaccgacgagaccccgcgcgccgtcaaccagggcgtggcgcct
gtgacctatggccagggcgaccggccaccccgcggcgactatgcccgcgcgcgtgccgac
tacacctgcgagcaggactgggccgcctatagcgaggccgagcatgcgctctaccgccgg
ctctatgagcgccaggcggcgcaactcccggggctggcctgcgaggagttcatcgaggcg
gtgcagcacctgggagcacccgaacagatcccgcgcttcgacagcttgagcgagcagttg
caccggaccacgggttgggaggtggtggcggtgccgggtttgatccccgaggaagccttc
ttcaagctgctgtcgcagcggcgcttcccggtcacgcaatggatacggcgaccggacgaa
ttcgactacgtggtggagcccgacctcttccacgacttgttcggccacgtgccgctgctg
ttcaacccggtctttgccgactacatgcaggcttacggcgcgggcggcctgaaggcgagc
gggctgaatgcctgcgagctgctggcgcggctgtactggtacacggtggagttcgggctg
atcgcgacgccgcaaggtgtgcgggcctacggcgccggcatcttgtcgtcggccggagaa
ctgccccacagcgtgcgcgtggcacagcccaagcatgtgcccttcgacctgctgcgcgtg
atgcgcacccgctacaagatcgacgcctaccaggagacctacttcgtgatcgactcgttc
cagcagctcttcgaggccacggcgcccgacttcgcacctctgtacgagcaggtgcgcggg
ctgcctgagatcgaggccggggtggtgctgccgcacgaagcaccgccccgtgtgctcgcg
tag

DBGET integrated database retrieval system