KEGG   Polyangium brachysporum: AAW51_5057Help
Entry
AAW51_5057        CDS       T04216                                 

Gene name
rbcS
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pbh  Polyangium brachysporum
Pathway
pbh00630  Glyoxylate and dicarboxylate metabolism
pbh01100  Metabolic pathways
pbh01110  Biosynthesis of secondary metabolites
pbh01120  Microbial metabolism in diverse environments
pbh01130  Biosynthesis of antibiotics
pbh01200  Carbon metabolism
Module
pbh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AAW51_5057 (rbcS)
Enzymes [BR:pbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AAW51_5057 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AKJ31748
UniProt: A0A0G3BUQ3
Position
5913793..5914233
Genome map
AA seq 146 aa AA seqDB search
MMTNPTGRLTQGQFSFLPDLTDAEIALQIEYGLNRGYAWSVEYTDDPHPRNTYWEMFGHP
MFDLRDAAGVLMELNHCRKTFPRHYIRLLAFDSTRGVESVAMSFIVNRPAVEPGFGTERQ
EGPGRTLRYTARAYSARSPEGERYGQ
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaacccgaccgggcgcttgacccagggccagttcagctttctgcccgacctg
accgacgccgagatcgcgctgcagatcgagtacggcctcaaccggggttatgcctggagc
gtcgaatacaccgacgatccgcatccgcgcaacacgtattgggagatgttcggccacccg
atgttcgacctgcgcgacgcggccggcgtgctgatggagttgaaccactgccgcaagacc
ttcccgcgccactacatccgcttgctggccttcgactcgacccggggtgtcgaaagtgtc
gcgatgagcttcatcgtcaaccgtccggcggtcgaacccggcttcggcaccgagcgccag
gaaggcccgggccgcaccttgcgctacaccgcgcgcgcctactcggcgcgctcgcccgaa
ggggagcgttatggccagtga

DBGET integrated database retrieval system