KEGG   Polyangium brachysporum: AAW51_5413Help
Entry
AAW51_5413        CDS       T04216                                 

Gene name
putA
Definition
(GenBank) integrase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
pbh  Polyangium brachysporum
Pathway
pbh00250  Alanine, aspartate and glutamate metabolism
pbh00330  Arginine and proline metabolism
pbh01100  Metabolic pathways
pbh01110  Biosynthesis of secondary metabolites
pbh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pbh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AAW51_5413 (putA)
   00330 Arginine and proline metabolism
    AAW51_5413 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pbh03000]
    AAW51_5413 (putA)
Enzymes [BR:pbh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     AAW51_5413 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     AAW51_5413 (putA)
Transcription factors [BR:pbh03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    AAW51_5413 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg
Motif
Other DBs
NCBI-ProteinID: AKJ32104
UniProt: A0A0G3BRP9
Position
6320256..6323267
Genome map
AA seq 1003 aa AA seqDB search
MSTPVRFTAPPERMRLPAPDRPEAEVVKQLQQQPALPWEQVKATAAPWVKAVRERPAPFW
AMESLLKEYPLSTTEGLALMRLAEALLRVPDVDTAMALTADQLGRASFDKAGASDHPVLS
NLSANVIALSKKLLPGDAQKQPGLLQRLGAQTVVGAAVRALQLLGRQFVLGRNIAEAQRE
AQSQRREQATLCFSFDMLGEGARTEHDAERYLASYRHAIEQIARERRTDARPETGDGISI
KLSALFSRYEASQRERVFAVLLPRVWSLVELAAQAHLNLTIDAEESERLELSLDVFEALA
AQIAQHHPQWQGFGLAVQAYQTRSLAVVEEVARIGREHGLRLMVRLVKGAYWDGEIKRAQ
ELGLAGYPVFTRKEHTDLAYLACAQALLSHAPALYPQFATHNAGTVAAILRLAAARPVPF
EMQRLHGMGESLYREVLQHERVTLRVYAPVGEHRDLLAYLVRRLLENGANSSFVHQLADE
QVPIDTLLASPLHPPARPGLPLPLALYGAERRNSRGVDLACQAEREPLFAALRSAAVPPV
AEATPEQVAQAMQQLHAQCERWDAVPVTERAAVLRRAGDALESALPEFCGLLVREAHKVM
ADAVSEVRETVDFLRYYAAQAEQRLVPLTLPGPTGESNQLHLRGRGVFVCISPWNFPLAI
FTGQVVAALVAGNPVAAKPAEQTPAVARRMVELLHQAGIPREVLQLLHGPGETVGAALVR
DARCAGVAFTGSTQVAKLIQRSLAEKDGPIVPLIAETGGINAMVVDSTALPEQVVDAVVQ
SAFRSAGQRCSALRLLCVHDRIADGVLEMLGGAMHELVVGDTSVWATDVGPVIDAEAHEG
IGRQLVRLDREARLIARTPVPEGLNGHYIAPVAYELQRIADVRQEIFGPVLHVVRWGGAE
GPTLDALIQQINTLGYGLTLGVQTRIDGRAHQIAERARVGNVYVNRNMIGAVVGVQPFGG
EGLSGTGPKAGGPHYLPRFCAEQTVTINTAAAGGNATLLAGGF
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atgtccacccctgttcgcttcaccgcgccgcccgagcgcatgcgcctgcccgcccccgac
cgtcccgaggcggaggtggtcaagcagttgcagcagcagcccgccttgccgtgggagcag
gtgaaggcgacagcggcgccctgggtgaaagcggtgcgcgagcggccggcgccgttctgg
gcgatggaatcgctgctgaaggagtacccactgtcgaccaccgagggcctggcgctgatg
cgattggccgaggccttgctgcgggtccccgatgtcgacaccgcgatggcgctgacggcc
gaccagctggggcgcgccagcttcgacaaggccggggccagcgaccacccggtgctgtcg
aacctgtcggccaacgtgatcgccctgagcaagaaactgctgcccggcgatgcccagaag
cagccgggactgctgcagcgactgggcgcccagaccgtggtgggcgcagcggtgcgggcc
ctgcagctgttgggacgccagttcgtgctgggccgcaacatcgccgaggcgcagcgtgaa
gcgcaatcgcagcgacgcgagcaggcgacgctgtgcttcagcttcgacatgctgggcgaa
ggcgcccgcaccgagcacgacgccgagcggtatctcgcgtcctaccgccacgcgatcgag
cagatcgcgcgggaacgccgcaccgatgcccgccccgagaccggcgacggcatttcgatc
aagctgagcgccttgttctcacgctatgaagcgtcgcagcgcgagcgggttttcgcggtg
ctgttgccccgcgtctggtccttggtcgagctggcggcgcaggcccatctcaacctgacc
atcgacgccgaagaaagcgagcggctcgaactgtcgctcgacgtgttcgaggcgttggcc
gcgcagatcgcgcagcaccatccgcaatggcaggggttcggccttgcggtgcaggcctac
cagacgcgctcgctcgcggtggtcgaggaagtcgcccgcatcggccgcgagcacggcctg
cggctgatggtgcggctggtcaagggcgcctactgggacggcgagatcaaacgggctcag
gaactgggcctggccggctacccggtgttcacccgcaaggaacacaccgacctcgcctat
ctggcctgcgcccaggcgctgctgtcgcatgcgccggccctctatccgcagttcgccacg
cacaacgccggcaccgttgccgccatcctgcgcctggccgccgcgcggccggtgccgttc
gaaatgcaacgcctgcacggcatgggcgagagcctctaccgcgaggtgctgcagcacgag
cgtgtcacgctgcgcgtctatgcgccggtgggcgagcaccgcgacctgctggcctatctt
gtgcggcgcctgctggagaacggcgccaactcgtccttcgtgcaccaactggccgacgag
caggtaccgatcgacaccctgctggcatcgccgctgcacccgccggcacggcccgggctg
ccgctgcccttggccctctatggtgccgagcgccgcaactcgcgcggtgtcgacctcgcc
tgccaggccgaacgcgaacccttgttcgcggcgctgcgcagtgcggccgtgccgccggtt
gccgaggccacgccggaacaggtggcgcaggcgatgcagcaactgcacgcgcagtgcgaa
cgctgggacgcggtgccggtgaccgagcgcgccgcggtgctgcgacgtgccggcgacgcc
ctcgagtcggccctgcccgagttttgcggcctgctggtgcgcgaggcccacaaggtgatg
gcggatgccgtctcggaggtgcgcgagacggtggacttcctgcgctactacgcggcgcaa
gccgagcagcgtttggtgccgttgaccttgccggggcccaccggcgagtcgaaccagctg
cacctgcgcggccgcggtgtgttcgtctgcatcagcccgtggaacttcccgctcgcgatc
ttcaccggtcaggtggtggcggcgctggtcgccggcaacccggtggccgccaaacccgcg
gagcagacaccggcagtggcacgccgtatggtcgagctgctgcaccaggccggcatcccg
cgggaagtgctgcaactgctgcacggcccgggcgagaccgtgggcgcggccttggtacgc
gatgcgcgctgcgcgggggtcgccttcaccggctcgacgcaggtggccaagctcatccag
cgcagcctcgccgagaaggacgggccgatcgtgccgctgatcgccgagaccggcggcatc
aacgcgatggtggtcgactcgaccgccctgcccgagcaagtggtcgacgcggtggtgcaa
agcgccttccgctcggccgggcagcgctgctcggcactgcggctgctgtgtgtgcatgac
cgcatcgccgatggcgtgctcgagatgctcggcggcgcgatgcacgagctggtggtcggc
gacacgtccgtctgggccacggatgtggggccggtgatcgatgccgaagcacacgagggc
atcgggcggcagctggtacggctggaccgtgaagcccggttgatcgcccgcacgccggtc
ccggaggggctgaacggccactacatcgccccggtcgcctacgaactgcagcgcatcgcc
gacgtacgccaggagatcttcggcccggtgctgcacgtggtgcgatggggcggcgctgaa
gggccgacactcgacgccctgatccagcagatcaacacgctcggctacggcctcacgctg
ggtgtgcagacgcgcatcgacggacgcgcccaccagatcgccgagcgcgcccgcgtcggc
aacgtctacgtcaaccgcaacatgatcggtgcagtggtgggcgtgcagcccttcggcggc
gaaggcctgagcggcaccggccccaaagcgggcgggccgcactatctgccgcgcttctgc
gccgagcagacggtgacgatcaacactgcggcagccggcggcaatgcgacgttgctcgca
ggcggcttctga

DBGET integrated database retrieval system