KEGG   Python bivittatus (Burmese python): 103048175Help
Entry
103048175         CDS       T03091                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00511  Other glycan degradation
pbi00600  Sphingolipid metabolism
pbi01100  Metabolic pathways
pbi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103048175
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103048175
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103048175
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     103048175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-GeneID: 103048175
NCBI-ProteinID: XP_025026952
Position
Unknown
AA seq 525 aa AA seqDB search
MQTREAFGVLFLILQGMTGARASQPCIPKFFGKNAMVCVCNATYCDTLDPVSLPDVGNYL
TYTTSLAGQRLERSEGKISPKRGVLSGLSYTYNPDVQYQRIKGFGGANTDAAAVNIMKLS
SAAQNHLLRSYFSEEGIEYNLLRWPIACSDFSMRPYSYDDRCRDDFELKCFSLAPEDTKL
RIPLLYRFMAASKRPLSLIASPWTSPGWLRVSNKVQGKSWLKGKPGDRYFDTWARYLIRF
LDEYSKYNITFWAISSQNEPFTPTFMPIKDFPSNYFSPQTQRDFFIKDLGPALAASFHRN
VHLITLDDTRVLLPTWANVVIGNHSAAKFVSGIGIHWYVDPVVPPGPTLEAIHRLYPNVF
MLYTESCNGFLPWDVKVDLGNWKRGVAYSRNILTNLNHFVSGWIDWNLALDMEGGPNWVE
NFVDSPIIVNHLKDEFYKQPMFYHLGHFSKFIPEGSVRVALSSNCFISCQLKSAAFLRPD
GVAVVVLSNDWSLDVTISILDNRVGYIEDRVPAYSIQTYLWRWHP
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgcgtgaggcttttggggtgctgttcctcatccttcaagggatgaccggggct
cgagccagccaaccttgtatccctaaattttttggcaaaaatgcaatggtgtgtgtctgc
aacgcgacctactgcgacacgctggacccggtctccctccccgatgttggcaactatctg
acatatacaaccagcctggccggccaacgcttggagcgcagcgaagggaaaataagtccc
aagcggggagttctgagcggcctttcttacacctacaatcccgacgtccagtatcaacgc
atcaaaggttttggcggagcgaacaccgatgctgccgccgttaacatcatgaagttgtct
tctgcagcccaaaaccacctgctccgctcttacttctctgaagaaggaattgagtacaat
ctgctgcgctggcccatcgcgtgctccgacttttccatgcggccgtacagttatgacgac
cgctgcagggatgactttgaactcaagtgtttcagcctggccccggaagataccaagctt
aggatccccctgctctaccgtttcatggcagcctccaagagacctctgtccctgattgcc
agcccttggaccagtcctggctggctaagggtcagcaacaaggttcaaggcaagtcctgg
ttaaagggaaaaccgggcgaccgttacttcgacacatgggctcgctatcttatcaggttc
ctagatgaatattctaaatacaacatcactttctgggcaatctcttctcagaacgagccg
ttcacccccacttttatgcctataaaggatttccccagcaattatttctcaccccaaaca
cagcgtgactttttcattaaggacctggggcctgcccttgctgccagcttccacagaaac
gtccacctgatcaccctggacgacacgagggttctcctgccaacatgggccaacgtggtg
attggcaatcatagcgctgctaagtttgtgtcgggcattggaatccattggtacgttgac
cccgttgtccctccaggacccactttagaagccatccatcgcctctaccccaatgtcttt
atgctgtacacagaatcttgcaacgggtttctaccttgggacgtgaaagttgatctggga
aactggaagcgaggcgtcgcttacagccgaaatatcctgacgaatctcaaccattttgtc
tcagggtggattgactggaacttggctctcgacatggaagggggacccaactgggtagaa
aattttgtcgatagtccaatcattgtgaaccacctgaaagacgaattctacaaacagccc
atgttctaccacctcggacatttcagcaaattcatccccgaaggctctgtgcgagtcgcg
ctctcctccaactgcttcatctcctgccagcttaagagtgcagctttcttgcggcccgac
ggcgtcgcagtggtggtgttgtcgaacgactggtctctcgatgttactatttctattttg
gacaaccgcgtgggttatatcgaggaccgcgtgccggcttactccatccaaacttatctg
tggagatggcacccttga

DBGET integrated database retrieval system