KEGG   Python bivittatus (Burmese python): 103048183Help
Entry
103048183         CDS       T03091                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1-like isoform X2
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00071  Fatty acid degradation
pbi00592  alpha-Linolenic acid metabolism
pbi01040  Biosynthesis of unsaturated fatty acids
pbi01100  Metabolic pathways
pbi01212  Fatty acid metabolism
pbi03320  PPAR signaling pathway
pbi04146  Peroxisome
Module
pbi_M00087  beta-Oxidation
pbi_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103048183
   00592 alpha-Linolenic acid metabolism
    103048183
   01040 Biosynthesis of unsaturated fatty acids
    103048183
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103048183
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    103048183
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     103048183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_ox_N Acyl-CoA_dh_M
Motif
Other DBs
NCBI-GeneID: 103048183
NCBI-ProteinID: XP_007437682
Position
Unknown
AA seq 385 aa AA seqDB search
MAESMNPDLRKEREAASFKAELLTNILDGGAERTRRRKEIEAIANEASFKHEDVNYLSRS
QRYEIAIKKSALMVMKLREYGIADPDEIYWFKSCLHHGRPEPLDLHLGMFLPTLLTQATQ
EQQDRFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTATYDPATQEFILNSPTVTSIKWWP
GGLGKTSNYAIVLAQLYTQNKCHGLHAFIVPLRQLGTHEPLPGITIGDIGPKFGYDEMDN
GYLKMDNFRIPRENMLMKHAKVEPDGTYVKPLNAKLTYGTMVFIRSIIVGDAARSLARAC
TIAIRYSAIRHQSELQPGEPEPQILDYQTQQYKLFPLLATAYAFHFVGAYMKDTYRRITG
NINEGDLSELPEVGLLFLLNTESYH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagcatgaacccggatcttcggaaggagcgggaggcagcttctttcaaggcg
gagctgctgaccaacatcttggacgggggtgccgagcggacccggcgccgcaaggaaatc
gaagctattgcaaatgaagccagtttcaaacatgaagatgtaaattacctctcccgcagc
caacgctatgaaatagctatcaaaaagagtgctcttatggtgatgaaactcagagaatat
gggattgcagaccctgacgagatctactggtttaaaagctgtcttcatcatggacggcct
gagcctttggacctccacctgggcatgttcctgcccacattgctaacccaggcaacccaa
gaacagcaggatcgcttcttcatgcctgcttggaacttggagatcattggcacatatgcc
cagacagagatgggacatggaacccatctccggggactggaaaccacagccacctatgat
cctgctacccaagaattcatccttaacagtccaactgtgacttctattaagtggtggcca
ggtggattgggtaagacatcaaactatgccattgttttggctcagctttatacccagaac
aaatgtcatgggttacatgctttcattgtgcctctacgtcagttgggaactcatgaacca
ttgccaggcattaccatcggtgacattggcccaaaatttggttatgatgaaatggataac
ggttacttaaaaatggacaatttccgcattccccgggaaaatatgctaatgaaacatgcc
aaggttgaaccagatggcacatatgtgaagcctctcaatgccaagctaacttacgggacc
atggtgttcatccgttcaattattgttggagatgcagctcgcagtttagccagagcttgt
acaattgccatccgctatagtgccataagacatcagtcggagttacagcctggggagcca
gagcctcagattttggattatcaaactcagcagtacaaactctttcctctcctagcaaca
gcatatgctttccactttgtgggtgcctatatgaaagatacatatcgtcgcatcactggg
aacatcaatgagggagacctgagtgagctgccagaggtagggctcttgttcttactgaat
actgaatcttaccattga

DBGET integrated database retrieval system