KEGG   Python bivittatus (Burmese python): 103048634Help
Entry
103048634         CDS       T03091                                 

Gene name
MARS2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00450  Selenocompound metabolism
pbi00970  Aminoacyl-tRNA biosynthesis
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    103048634 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103048634 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pbi01007]
    103048634 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pbi03016]
    103048634 (MARS2)
Enzymes [BR:pbi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     103048634 (MARS2)
Amino acid related enzymes [BR:pbi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   103048634 (MARS2)
Transfer RNA biogenesis [BR:pbi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103048634 (MARS2)
 Prokaryotic type
   Other AARSs
    103048634 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 103048634
NCBI-ProteinID: XP_025026504
Position
Unknown
AA seq 521 aa AA seqDB search
MALMAGNECIYLFVLSFFSFPGTDEHGLKIQTAATAAGISPKEFCDRVSAEFRELFAQAG
ISYTDFIRTTELRHRRAVECFWAALQGGGSLYRAHYEGWYCTAEESFLAASQVTERPDAQ
GSKQMVSLESGHQVHWTREENYMFKLSEFREPLQRWLCENKDAINPEPYYQQVLQWLEED
LPDLSVSRDRNRLHWGIPVPGDSTQTIYVWVDALVNYLTAVGYPEEHQAWWPTACHIVGK
DILKFHAIYWPALLMAAGLEPPLQIQVHSHWTVQGQKMSKSLGNVIAPKDCFQHYTLDGF
RYFLLRQGVPEWDCDYYDEKVIKLLNSELADALGGLLNRCTAPALNPSGTYPIFSEACFP
RDRGTQTRSGQASAEDYKLVSLVESLPLKVSTSFDRFQIYKALESIMECVRQTNGFIQRH
RPWKLCPEDPAQRQWQETILHVSLECLRVYGLLLQPVVPAMSDKLLSRLGVSPTERSLKN
LNFLPRYHGRKCPFEGRKLGPDPGLLFPRLKKSEASNCTGP
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatggcagggaacgaatgcatttatttatttgtactgtcctttttttccttc
ccaggaacagatgagcatggcttgaaaattcagacggcagccacagctgcaggtatttcc
ccaaaagagttctgtgaccgtgtatcagctgaattccgggagctctttgcacaggccggc
atctcctacaccgattttatccgcaccacagagctacggcaccgtcgggctgtcgaatgc
ttctgggctgccttgcagggtgggggctcgctctatcgcgctcactatgaggggtggtat
tgcacagcagaggagagctttttggcagcgtcccaggtgacggagcgccctgatgcccaa
gggagcaagcagatggtttccttagagagtgggcaccaggtgcactggactagagaggaa
aactacatgttcaagctgtctgagttccgggagccattgcagcgatggctctgtgagaat
aaggatgccataaaccctgagccctactatcagcaggtactccagtggctggaagaggac
ctacctgatctctctgtatcgcgtgaccgaaaccggctgcattggggtatccctgtccct
ggggactcaacacaaaccatctatgtctgggtggatgctctggtgaactacctgacggct
gtaggttaccctgaggagcaccaggcctggtggcccaccgcttgccacattgtgggcaaa
gacatcctcaagttccatgccatctactggcctgccctgctgatggctgccggcctggag
ccccccctgcagatccaggtccactctcattggacggtgcaaggacagaagatgtccaag
agcttggggaatgtcattgccccaaaggactgcttccagcattacacgctggatggtttt
cggtacttcctgctgagacagggtgtcccagaatgggattgtgattactatgatgagaaa
gtgattaagctgctcaactcggagctggccgatgccttaggggggctccttaaccggtgc
acggcccctgccctgaatcccagtgggacttatcccatcttctcagaggcgtgcttccct
agggacagggggactcagactagatctggccaggcttcagcggaggactacaagctggtg
tccttggtagagagcctgcctctgaaagtgagcacctcttttgatcgcttccagatctac
aaggctctggaatccattatggaatgtgtgagacagaccaacggcttcatccagaggcac
aggccatggaaactctgccctgaggatccagcacagcggcagtggcaagagaccattctc
catgtcagcctggaatgtcttcgggtatatgggctcctgctgcaaccggtggtcccagcc
atgtctgacaagcttctctcaaggttgggtgtttctcccacagaaagatctctaaagaac
ttgaactttcttcctcgctaccatggcagaaaatgcccctttgaaggcaggaagcttggt
ccagatccaggtctcctgtttcccaggctgaagaaatctgaagccagcaattgtacaggt
ccttaa

DBGET integrated database retrieval system