KEGG   Python bivittatus (Burmese python): 103049748Help
Entry
103049748         CDS       T03091                                 

Gene name
PIK3C2A
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00562  Inositol phosphate metabolism
pbi01100  Metabolic pathways
pbi04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103049748 (PIK3C2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    103049748 (PIK3C2A)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     103049748 (PIK3C2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 103049748
NCBI-ProteinID: XP_007436310
Position
Unknown
AA seq 1702 aa AA seqDB search
MDICFHRMAQIFSSNEFKQRSSPVLDTARPKEVDKEEALQMEAEALAKMQKERVVVGNRQ
NSDTLSYSWPSVQSCRKQDHDLMVFPESDGKKKVHDKLNSIDIDKLTCAELEKLLLEENL
ESHKPSTLSATPILGASSSQFYSHPVAQRGQWTSGLPGSSTCAGPSAYSAPSFSKQVGIF
QNGFHPGISTYQSTKPIYLRLPERSQYISYALPFTSTFHPQGSVPMYHSTLTPEMAKVFD
KIASTSEFQKNGKSNTDLEMTGAKSAISLPTSESSSDISKFDWLDLDPLSKPKVDNMDIF
YTSEDGGKVTSTKVVEDPWDAVLLEEKSPGKSHLERKVSGKSPSGATVTRSQSLNIRTAQ
LAKLQGQTSQTDNGTSSLPAENKLLKNVEWQNQEQTAFCDVIAKLRTKFPHSNHDTNLGF
VLSPVMLQRNISGENSSIKISIEIEGFQQPVTFTCDVSSPVELIIMQALCWVHDDLNDVD
IGSYILKVCGQEEVLQNKHSVGSHEYIQNCRKWDTEIILQLLTHNVICRDMARTEDDDGT
PIDLTKHLCHVEKFFRETIQSHSLEELLEAYHNQVDILLKNKNRFKAAEPVIKAVRKICY
ALDGVEIPAITTAVKKLRRTVNLPGNENPEGSVISSDDTSKNPIGRLQSENPLQMSVDQL
TSAVHALLQLHLNSCHSPSLSTPRITKSTKEAWTATEHLQFTIFAAHGIPNNWVSAYEKY
YLVCSLTHNGKDLFKPVQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESILCLTLFGI
LNQNGGNSPDSNKQRKGPEILGQVSIPLFDFGRMLTCGTKLLHLWTPSASSNIVPGVAHK
KGTLMERIVLQVDFPSLPFDIIYKIPQAANNSVCNSIETLEKDSRERLLSILSREGIFGL
SRKDKAFLWEKRHYCYTHANSLPKILASAPNWDLTNLPEIYLLLQQWPPLPPLIALELLD
SNFADQEVRTKAVQWIEAISDDELADILPQFVQALKHETYLDNSLVKFLLARALGNIRIA
HYLYWLLKDTLNDTKHGIRYGHILGAFLSICGKSLTEELEKQSRLVQILGMVAEKVKQTS
GSARQMVLQSGMERVQSFFLKNKCRLPLSPSLVAKGLNVKACSYFSSNAVPLKIALVNAD
PLGEEINVMFKVGEDLRQDMLALQMIKIMDKIWLQEGLDLRMVMFKCLATGKDRGMVELV
PASDTLRKIQVEYGVTGSFKDKPLAEWLRKYNSTEEEYEKASENFIYSCAGCCVATYVLG
ICDRHNDNIMLRSTGHMFHIDFGKFLGRAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTI
RFQLFVDLCCQAYNLIRKQANLFLNLLSLMMSSGLPELTGPQDLKYVQDALQPQTTDAEA
TIFFTRLIESSLGSVATKFNFFIHNLAQLRFSGLPSNDEPILSFSPKTYSLKQDGRIKEA
SVFTYHKRYNPDKYYIYVVRVLREGQTEPTFIFRTFDEFQEFHNKLGILFPLWKLPGFPS
KMVLGRTHVKDVAAKRKVELNSYIQSLMNASTDVSECDLVYTFFHPLLRDEKAEGIDGIT
RCTDVGPSSPTSGKVGGEVKLSISYRNKTLFIMVMHIKDLVTDDGADPNPYVKTYLLPDM
HKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLKQRELQLSVLSAESLRENFFLGGITLS
LKDFNLSKETVNWYRLAAAPYL
NT seq 5109 nt NT seq  +upstreamnt  +downstreamnt
atggacatctgctttcacagaatggcccagatatttagcagtaatgaattcaaacaacgt
tcatcaccagttttggatactgcaaggcccaaagaagtggataaagaagaagcgctgcaa
atggaagctgaggctctggctaagatgcaaaaagaaagagtagtggttggcaatagacaa
aacagtgacaccttaagctactcttggccaagtgtacagtcctgcagaaaacaagatcac
gatcttatggtatttccagagtctgatggcaagaagaaggtgcatgataagttaaactca
attgacatagacaaacttacatgtgctgaattagagaaacttcttctagaagaaaatctt
gaatcccacaaaccatctacattgtcagccactcctattcttggggcatcatcttcccaa
ttttattctcatcctgttgctcaaagagggcagtggacatctggtttgcctggatcttct
acttgtgctggaccttctgcttactcagcaccttctttcagtaaacaagttggtatcttt
caaaacggctttcatccaggtatatccacttatcaatctacaaagcctatatatcttcgt
cttccagaaaggtcccaatacatttcatatgcactgccatttacttcaactttccatccg
caaggaagtgtgcctatgtatcattcaacacttacccctgaaatggcaaaagtatttgat
aagattgcaagtacttcagaatttcaaaaaaatgggaaatcaaacacagacttagaaatg
actggtgctaaatctgctattagtttgccaacctctgaaagctccagtgatattagtaaa
tttgattggttggatttagatcctttaagtaaaccaaaggtggacaatatggatatattt
tatacttcagaagatggaggaaaggtaactagtactaaagttgtagaagatccttgggat
gctgtgctgctagaagagaagtctccaggaaagagccatcttgaaagaaaagttagtgga
aaatctccttctggggcaacagttacaagaagtcaatctttaaacattcgaactgctcag
cttgctaaattacagggccaaacttcacagacagacaatgggaccagtagcctgccagca
gaaaataaacttctaaaaaatgttgaatggcaaaatcaagaacaaacagcattttgtgat
gtcattgcaaaattaaggaccaagtttccccacagcaatcatgatacgaacttgggtttc
gtgttgagtccggtcatgttgcaaagaaatataagtggagaaaactccagcatcaagatt
tcaatagaaattgaaggtttccaacagccagtgacatttacatgtgatgtgagttctcca
gttgaacttataataatgcaggctctttgctgggtgcatgatgacttgaatgatgtagat
attggcagttatattttgaaagtttgtggacaagaagaagttttacagaacaagcatagt
gttggaagccatgagtatattcaaaactgccgaaagtgggacacagagattattctgcag
ctattgacccataatgttatatgcagagatatggcacgaacagaagatgatgatgggaca
cccatagatttgacaaaacatctctgccatgtagaaaagtttttcagagagaccattcag
agccactctcttgaagaactgttagaagcttatcacaatcaagttgatatactacttaaa
aataagaatcggtttaaagcagcagaaccagtcattaaagcagtcagaaaaatttgctat
gcattagatggggtagagattcctgcaattactacagctgtaaagaagctaagaagaaca
gtcaaccttccagggaacgagaaccctgagggatctgtaatatcatctgatgacactagc
aagaatccaattggtcgtttgcaatctgaaaatcctcttcaaatgagcgtagatcagctg
acctcagcagtccatgctcttcttcaactccacttgaactcatgccacagtccttcatta
agcactccaaggattacaaaaagcactaaagaagcatggactgccacagagcacctccag
ttcacaatatttgctgctcatggaattcccaataattgggtttcagcttatgaaaaatat
tatctggtttgttctttgacccataatggaaaagatctcttcaaaccagtgcagtccaag
aaggttggcacatataagaatttcttctatttgattaaatgggatgaattaataattttt
cccatccaaatctctcagttgccattagaatccatcctatgccttactctgtttggtatt
ttaaatcaaaatggtggtaattcacctgattcaaataaacagagaaaaggcccagagata
ttgggtcaggtttccatacctctctttgactttggacgaatgttaacttgtgggacaaaa
ctcttacatctttggacaccttctgcaagctcaaacattgttcctggagtggcccataag
aaaggaaccctaatggaaaggatagtgttgcaggtcgacttcccttccttaccatttgac
attatatacaaaattcctcaggctgcaaacaattctgtgtgtaattctatagaaacattg
gaaaaggattcaagggagcgtcttctttccattctttctagagagggtatatttgggtta
tctaggaaggataaagcatttttgtgggagaaacgacattattgttacacacatgcaaac
agcttgcccaagatactggctagtgctccaaactgggatttgacaaatcttcctgaaata
tatttgctgcttcagcagtggcctcctttacctccacttatcgcattagaattgctggac
tcaaattttgcagatcaagaagtaagaacaaaagctgtgcagtggattgaggcaataagc
gatgatgaacttgctgacattctcccccagtttgttcaggcattaaaacatgaaacatat
ctggacaactctttagtcaagttccttttggcccgagcattaggaaatattcgaatagca
cactacctgtattggttactaaaggataccttgaatgataccaaacatggcataaggtat
gggcatatccttggtgcctttctttccatctgtggcaaaagtctgacagaagaactggaa
aagcagtcaagacttgtgcagatcttagggatggttgcagaaaaagtaaagcagacaagt
ggatcagccagacagatggttctgcaaagtggaatggaacgtgtccaatcttttttcttg
aaaaacaaatgccgtctgcctctcagccccagtcttgtagctaaaggactgaatgtaaag
gcatgttcctatttcagttctaatgcagtccctcttaaaattgctttggtgaatgcagat
cctttgggagaagaaattaatgtaatgtttaaggttggagaagatctgcgccaagatatg
ttagcattgcaaatgataaagatcatggataagatttggttacaggaaggactggacttg
aggatggttatgttcaagtgccttgcaactggcaaagatagaggaatggtagaacttgtt
ccagcttcagatactcttaggaaaattcaagtggagtatggagtgacaggatcctttaaa
gataagccccttgcagaatggctaagaaaatacaactctacagaagaagaatatgaaaag
gcttctgaaaacttcatctattcctgtgctggatgttgtgtggccacctatgtgctaggt
atctgcgatcgccacaatgataacataatgcttcgaagtacaggacatatgttccatatt
gattttggaaaattcttgggccgtgcacagatgtttggaagctttaaaagggatcgggct
ccttttgtgctgacatcagatatggcctacgttatcaatggtggtgaaaagcccactatt
cgtttccagttgttcgttgatctgtgctgccaagcttataatctaatcagaaaacaagcc
aaccttttccttaatctgctgtcattgatgatgtcttctggcttgccagaacttactgga
cctcaagatctcaagtatgtccaggatgcccttcagccccaaactactgatgctgaggct
accattttctttacaaggctgattgaatcaagtttgggaagtgttgccacaaagttcaac
ttttttattcacaaccttgctcagctgcgtttctcagggctgccttctaatgatgagcca
atcctctcgttttcacctaaaacatactcactcaaacaagacggtcgtatcaaagaagca
tctgtctttacataccataaaagatacaacccagataaatattatatttacgtggtcaga
gttttgagagaagggcaaactgaacccacattcatttttcgtacatttgatgagttccag
gagtttcataataagcttggtatcctatttcctctttggaaattaccaggctttcccagt
aagatggttttaggaagaactcatgtaaaggatgtagcagccaagagaaaagtagagctg
aatagctacatacaaagtttaatgaatgcatcaacagatgtatcagagtgtgatctggtt
tatactttcttccatcccttacttcgtgatgaaaaagctgaaggaattgatggaataact
aggtgtacagatgtaggcccttcaagtcctacctcaggcaaagtaggaggagaggttaag
ttgtccatctcctatagaaacaagactctgtttatcatggtgatgcacattaaagatttg
gttactgatgatggtgcagatccaaatccatatgtgaagacatatttgcttcctgacatg
cataaaacatctaaacggaaaaccaaaatatcacggaaaactagaaatccaacattcaat
gaaatgcttgtgtacagtggatatagcaaagaaacactcaagcaaagggaacttcagcta
agtgtactcagtgctgaatccctgcgtgaaaactttttcctgggtggaatcactctttcc
ttaaaggattttaacttaagcaaggagactgtgaactggtacaggcttgctgctgcacca
tacttatga

DBGET integrated database retrieval system