KEGG   Python bivittatus (Burmese python): 103049799Help
Entry
103049799         CDS       T03091                                 

Definition
(RefSeq) cis-aconitate decarboxylase
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    103049799
Enzymes [BR:pbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     103049799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 103049799
NCBI-ProteinID: XP_007445355
Position
Unknown
AA seq 366 aa AA seqDB search
QRVSPHLKASAGCQKPGAHLVPPSEQRASTCRSIAPSATNGCRLDSSRFHPPSILGTMGS
AAATAKLLRLDQFKCKEALAVAASYAGAPLANAATQTKPLHMGNASRHGVEAALLASLGL
QANKLILDLESGFGAFYTDYLPQTLPSLQSYSWLLDQQDVAFKSFPAHLGTHWVAEAALA
VRKHLARSGESLPSGRIKAIVLDIPNIGYVDRPFPSSEHEARHSFQLAACSALLDGAISA
KSFTPQSLSRPELSELLRKTRLEHSPDNLPSFNSLYCEAKVILQDGATWAERCDTFYGHW
RKPLSRGDLVKKFHSNAVVAVPREVAEGIVEAVDQLDTLEDCRALFSLLQGAELAKGQRQ
HRRETL
NT seq 1102 nt NT seq  +upstreamnt  +downstreamnt
tcagcgggtctctccccacctgaaggcatcagctgggtgtcagaagccgggcgctcacct
tgttccgccttcggagcagagagccagcacttgccgctccattgctccttctgccactaa
cgggtgccgtctggactcttccaggttccatcccccctccatcctcggcaccatggggag
tgctgcggccacggcgaagctcctgcgccttgaccagttcaagtgcaaggaagccctggc
ggtggctgcctcttatgccggtgccccactggccaatgcagccacgcagaccaagccact
tcacatgggcaacgccagccggcacggtgtggaagcggccctcctggcatccctgggcct
gcaagccaacaagctgattctggacctcgagtcgggcttcggggccttttacacggacta
cctgccccaaaccctgcccagcctgcagtcctactcttggctgttggaccaacaagacgt
ggccttcaagagcttcccagcacatctggggacacactgggtggccgaagccgccctggc
ggtaaggaagcaccttgcccggagtggagagtccctgcccagcggccgcatcaaggccat
cgtgcttgatattcccaacattggatacgttgatcggccatttccttcctcagaacacga
ggccaggcactccttccagctggctgcctgctcagcgctgctggatggcgccatctcggc
caaatccttcacgccgcagagcctctccaggccagagttgagcgaactgctccgaaagac
ccgcctggagcattctccggacaatctccccagcttcaacagcctttactgtgaagccaa
agtcatcctccaggacggagccacctgggcagagcgttgtgataccttctatgggcactg
gaggaagcccctgagccgtggggatttggtgaagaagtttcactccaacgccgtggtggc
ggtcccccgagaagtggccgaaggcattgtagaagcagttgatcagctggacaccctgga
agattgcagggcgttgttttcacttcttcaaggagcagagctggccaagggtcagcggca
acacaggagggagaccttgtga

DBGET integrated database retrieval system