KEGG   Python bivittatus (Burmese python): 103049930Help
Entry
103049930         CDS       T03091                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04010  MAPK signaling pathway
pbi04060  Cytokine-cytokine receptor interaction
pbi04068  FoxO signaling pathway
pbi04110  Cell cycle
pbi04218  Cellular senescence
pbi04350  TGF-beta signaling pathway
pbi04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103049930
   04350 TGF-beta signaling pathway
    103049930
   04068 FoxO signaling pathway
    103049930
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103049930
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103049930
   04218 Cellular senescence
    103049930
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103049930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pbi04052]
    103049930
   00536 Glycosaminoglycan binding proteins [BR:pbi00536]
    103049930
Cytokines and growth factors [BR:pbi04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103049930
Glycosaminoglycan binding proteins [BR:pbi00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   103049930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide SPEG_u2
Motif
Other DBs
NCBI-GeneID: 103049930
NCBI-ProteinID: XP_007440584
Position
Unknown
AA seq 115 aa AA seqDB search
MHCYLLSVFLTLDLATVAFALSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEEYPEP
EEVPPEVISIYNSTRDLLQEKANHRAASCEKERSDEEYYAKEVYKIDMGIYHPSA
NT seq 346 nt NT seq  +upstreamnt  +downstreamnt
atgcactgctatctcttgagcgtgttccttaccctggatctggccacggtggcctttgcc
ctctctacgtgcagcaccctcgacatggaccaattcatgcgtaagcggattgaggcgatc
cgaggccagatcctgagcaagctgaaactcaccagccctccggaagagtacccagagcct
gaggaggttcctccggaggtcatctcaatctacaacagcacaagggacttgctgcaggag
aaggcgaaccacagggcagcctcttgtgaaaaggagaggagtgatgaggaatattacgcc
aaagaagtttacaaaattgacatggggatttaccacccgtccgcaa

DBGET integrated database retrieval system