KEGG   Python bivittatus (Burmese python): 103049945Help
Entry
103049945         CDS       T03091                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform isoform X1
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00071  Fatty acid degradation
pbi01212  Fatty acid metabolism
pbi03320  PPAR signaling pathway
pbi04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103049945 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103049945 (CPT1B)
   03320 PPAR signaling pathway
    103049945 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pbi03029]
    103049945 (CPT1B)
Enzymes [BR:pbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     103049945 (CPT1B)
Mitochondrial biogenesis [BR:pbi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103049945 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 103049945
NCBI-ProteinID: XP_007443895
Position
Unknown
AA seq 780 aa AA seqDB search
MAEAHQAVAFQFTVTPEGVDFQLSREALKQVYLSGLSSWKKRFIRVKNGFLTGVYPGTPS
GWLVVTIATVSSTWVHVDVSKGLISSIQRHLPASCSCYFSLRQQTLLSALLFSTGVWLAG
IWLRRQMLKLLLSYHGWMFEPHGKTSFSTKVWVAMVKVMSGRHPMLYSFQTSLPKLPVPY
VEDTVQRYLDSVQPLLDKEKYDRMEALALDFRKNVAPRLQKYLILKSWWATNYVSDWWEE
YIYLRGRGPIMVNSNYYLMDFLYTTPTPIQAARAGNCVHAILMYRRQLDREELVPVMALG
VVPMCSYQMERMFNTTRIPGKEADSLLHLSDSKHLAVFHKGRFYKVWLYHGGKMLPPRDL
EMQFQRILDDPSPPQPGELRLAALTAGSRVPWAEARARYFSRGRNKASLECIDRAAFFLT
FDEEAQDYSREREESLDDYAKSLLHGRCYDRWFDKSFTLVVYPNGKVGGNAEHSWADAPI
MGHLWEFTLATDQFQLGYCSGGHCHGVPNTDLSPPQRLVWDLPEECIRVIDSSYGEARAL
ADDVDFSCFRFTSFGKGLIKKCRTSPDSFIQIALQLAHFRDRGHFCLTYEASMTRLFREG
RTETVRSCTQEAIAFVRSVADPNSSPSERLQLFRAAAEKHQQMYRLAMTGAGIDRHLFCL
YVMSRYLGVSSPFLDKVLSDPWRLSTSQTPQQQIKMFNLDSYPDYVSAGGGFGPVADDGY
GVSYIIVGENLIMFHISSKFSSPETDSKRFGRNVRQAMVDIATLLEVQAGRRARSAGGLC
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcccaccaggcggttgccttccagttcacggtcaccccagagggggtggat
ttccagctgagccgggaagcgctcaagcaggtctacctttcgggcctctcgtcctggaag
aagcggttcatccgggtcaagaacggcttcctgactggggtgtacccgggcacgccctcc
ggctggctggtcgtcaccattgcgacggtgagctctacgtgggtgcacgtggatgtctcc
aaggggctgatcagcagcatccagaggcacctgcccgccagctgcagctgctacttcagc
ctccgccagcagactctgctgagcgccctgctcttctccacgggcgtctggctcgcgggc
atctggctgcgccgccagatgctcaagctgctgctctcctaccacggctggatgttcgag
ccccacggcaagactagtttcagcaccaaagtctgggtggccatggtgaaagtgatgtcc
ggtcgccaccccatgctctacagctttcagacctccttgcccaagctgccggtgccttat
gtggaggacaccgtccagaggtatctggactctgtccagcccttgctggacaaggagaag
tacgaccggatggaagctctggccctggacttccggaagaacgtggcccctcggctccag
aagtatctcatcctcaagtcctggtgggccaccaactacgtgagcgactggtgggaggaa
tacatttatctccggggaaggggtcccatcatggtgaacagcaactactacctcatggat
tttctctacaccacccccacgccaattcaggctgcacgggctggcaactgtgtgcacgca
atcctgatgtaccggcgccagctggaccgggaagaacttgtgcccgtgatggcgctgggg
gtggtgcccatgtgctcctatcagatggaaaggatgttcaacacaacacgcatccctggc
aaagaggcagattcccttctgcacctgtccgacagcaagcacctggcggtcttccacaaa
gggcgcttctacaaggtctggctgtaccacggggggaagatgctgccgccccgtgacctc
gaaatgcagttccagcgcatcctggatgacccctcgccaccgcagcccggggagctgagg
ctggcggccctcacagcaggcagcagggttccgtgggccgaggcccgtgccaggtacttc
agccggggcaggaacaaggcatcgctggagtgcattgaccgagccgccttcttcctgacc
ttcgacgaagaggcgcaagactacagtcgagagcgggaggagagtctggacgattacgcc
aagagcctcctgcacggacgctgctatgaccggtggtttgacaagtccttcacgctggtg
gtctatccgaacggcaaggtgggcggcaacgccgagcactcgtgggccgatgctcccatc
atgggacacctctgggagttcacgctggcgacggaccagttccagctgggttactgcagt
ggcgggcactgccacggggtgcccaacaccgatctgtccccaccgcagcgtttggtgtgg
gaccttccagaagagtgcatcagggtcattgactcctcctatggcgaggcccgagccctg
gcggacgacgtggacttctcttgcttccggttcaccagttttggcaaagggctcatcaag
aaatgccggaccagccccgacagcttcatccagatcgctttgcagctggcgcacttccgg
gacaggggccacttctgcctcacctacgaggcctccatgacgcggctgttccgggagggc
cggacagagactgtgcgctcctgcacccaggaggcgattgcctttgtgcgcagcgtggcc
gaccccaacagcagcccctcggagcgcctgcagctgttccgggcggctgccgagaagcac
cagcagatgtaccgcctggccatgacaggggcgggcatcgaccggcatctcttctgcctc
tacgtgatgtcccgctacctcggcgtgagctccccctttctggacaaggtgctgtccgat
ccgtggcgcctctccaccagccagactccgcagcagcagatcaagatgttcaacctggac
tcctacccggattacgtctccgccggcggaggctttgggcctgtggctgatgacggctac
ggggtctcctatatcattgtgggcgagaacctgatcatgtttcacatttccagcaagttc
tccagccctgagacggactccaagcgcttcgggaggaacgtccggcaggccatggtggac
atcgccacgctgcttgaggtgcaggccgggagaagggcccgctcagcggggggcctttgc
tga

DBGET integrated database retrieval system