KEGG   Python bivittatus (Burmese python): 103049990Help
Entry
103049990         CDS       T03091                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock-related 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi03040  Spliceosome
pbi04010  MAPK signaling pathway
pbi04141  Protein processing in endoplasmic reticulum
pbi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103049990 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103049990 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103049990 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103049990 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pbi01009]
    103049990 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pbi03041]
    103049990 (HSPA2)
   03009 Ribosome biogenesis [BR:pbi03009]
    103049990 (HSPA2)
   03110 Chaperones and folding catalysts [BR:pbi03110]
    103049990 (HSPA2)
   04131 Membrane trafficking [BR:pbi04131]
    103049990 (HSPA2)
   03051 Proteasome [BR:pbi03051]
    103049990 (HSPA2)
   03029 Mitochondrial biogenesis [BR:pbi03029]
    103049990 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbi04147]
    103049990 (HSPA2)
Protein phosphatases and associated proteins [BR:pbi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103049990 (HSPA2)
Spliceosome [BR:pbi03041]
 Complex B
  Other components
   Prp19 complex
    103049990 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    103049990 (HSPA2)
Ribosome biogenesis [BR:pbi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103049990 (HSPA2)
Chaperones and folding catalysts [BR:pbi03110]
 Heat shock proteins
  HSP70 / DNAK
   103049990 (HSPA2)
Membrane trafficking [BR:pbi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103049990 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103049990 (HSPA2)
Proteasome [BR:pbi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103049990 (HSPA2)
Mitochondrial biogenesis [BR:pbi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103049990 (HSPA2)
Exosome [BR:pbi04147]
 Exosomal proteins
  Proteins found in most exosomes
   103049990 (HSPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C CRIC_ras_sig Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 103049990
NCBI-ProteinID: XP_007435687
Position
Unknown
AA seq 635 aa AA seqDB search
MSGKAPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPNNTIFDAKRLIGRKFDDPTVQSDMKHWPFRVVSEAGKPKVQVEYKAEVKTFFPEEI
SSMVLTKMKEIAEAYLGCKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGSRAGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHFVEEFKRKHKRDIAGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLFDGIDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQINEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGIETAGGVMTALIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAVDKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKAEDEANRERVV
SKNALESYAYNIKQTVEDDKLKGKISEQDKQRVLEKCQEVISWLDRNQMAEKEEFEHKQK
ELEKLCNPIIAKLYQGAGAAGAGAPGGGPTIEEVD
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaaagcgcctgccataggcattgacttgggcaccacatactcctgcgtcgga
gttttccagcacgggaaggtggagatcattgccaacgaccaaggaaaccgcactactccg
agctatgttgcctttacggatactgaacgcctcatcggagatgcagccaagaatcaagtg
gccatgaatcccaacaacaccatctttgatgccaagcgtctcattggccgcaaattcgat
gatcctacggtgcagtccgatatgaagcactggccttttcgtgtggtgagtgaagctggg
aagccaaaggtacaagttgagtacaaggctgaggtcaagactttctttcctgaagaaatt
tcctcgatggtgttgaccaaaatgaaggaaatagctgaggcatacctgggttgcaaagtc
cagagtgctgtaatcactgtacctgcatacttcaatgactcccaacgccaagccaccaaa
gatgcaggaaccatcacaggtctcaatgtactgcgcatcattaatgagcccacagctgct
gccattgcctatggtttggataaaaaagggagcagagcaggtgagaagaatgtgctgatc
tttgacttgggtggtggcacttttgatgtctccattttgaccattgaagatggcatcttt
gaagtgaaatctactgctggagatactcacttgggtggtgaggactttgacaatcgtatg
gtgagtcactttgtggaggaattcaagcgcaagcataagcgtgacattgctggcaacaag
cgagcagttaggcggctccgcacagcctgtgagagagccaaacgtaccctgagttcctcc
acccaagcttctattgagattgactcattatttgatggaattgatttctacacatccatc
acccgtgctcgctttgaagagctcaatgctgatctcttccgcggtactcttgaacctgtg
gagaaggctcttcgtgatgctaagctggacaaagggcagatcaatgaaattgttctagtc
ggtggctcaactcgtatccccaagatccaaaagttgctacaagacttctttaatggaaaa
gagctgaacaaaagcataaatcctgatgaagctgtggcatatggtgctgctgtgcaggct
gctattctgatgggtgacaaatcagaaaatgtgcaagacctcctgctgcttgatgtagca
ccactttctctgggtattgagactgctggtggtgtaatgactgccttaatcaagcgtaac
acaactattcccaccaagcaaacccagaccttcaccacctattcagacaaccagagtagt
gtgctggtgcaagtgtatgagggtgagcgggccatgactaaggacaacaatctgctgggc
aaatttgacttgacgggtatcccacctgcacctcgtggtgtgccccaaattgaggttaca
tttgacattgatgcaaatggtatcctcaatgtcactgcagtggacaagagcacaggaaaa
gagaacaagattacaattacaaatgacaaaggccgtcttagcaaagatgacattgaccgc
atggtgcaagaagcagagcgttacaaggcagaggatgaggctaaccgggaacgggtagtt
tccaaaaatgccctggagtcctatgcatacaacatcaagcagactgtggaggatgacaag
ctgaaaggcaagattagtgagcaggacaagcagagagtgcttgaaaagtgccaggaggtg
atcagctggcttgatcgaaaccagatggctgagaaggaagagtttgagcacaagcagaag
gagctagagaagctttgcaaccccatcattgccaaattgtaccagggtgctggagctgcg
ggtgctggtgctccaggtggtggtcccactattgaagaagtagattaa

DBGET integrated database retrieval system