KEGG   Python bivittatus (Burmese python): 103050681Help
Entry
103050681         CDS       T03091                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04270  Vascular smooth muscle contraction
pbi04371  Apelin signaling pathway
pbi04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103050681 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103050681 (GNA13)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103050681 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbi04147]
    103050681 (GNA13)
   04031 GTP-binding proteins [BR:pbi04031]
    103050681 (GNA13)
Exosome [BR:pbi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103050681 (GNA13)
  Exosomal proteins of colorectal cancer cells
   103050681 (GNA13)
GTP-binding proteins [BR:pbi04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    103050681 (GNA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 103050681
NCBI-ProteinID: XP_007421675
Position
Unknown
AA seq 376 aa AA seqDB search
MADFLPSRSPLSGCFPGCMLNSSEAEQQRKSKEIDKCLYREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDWDRPAREEFRATIYSNVIRGVRVLVDAREKLHIPWGNPANQKNGD
KMMAFDTRLEVVKGMVQTQTFLQYLPTVRALWADSGIQHAYDRRREFQLGESIKYFLDNL
DKLGDPDYLPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVT
SILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKVQ
KVSIKDYFPEFEGDPHNLTDVQKFLVDCFRTKRRDQQQKPLYHHFTTAINTENIRLVFRD
VKDTILHDNLKQLMLQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcctgccgtcgcggtccccgctgtcgggctgcttccccggctgtatgctg
aacagcagcgaggccgagcagcagcggaagtctaaagagatcgataagtgcctgtaccgc
gagaaaacctacgtcaagcggctcgtcaagatccttctgctgggcgcgggggaaagcggc
aagagtacgttcctcaagcagatgcgcatcattcacgggcaggactgggaccggccagcc
cgggaggaattccgcgccaccatctacagcaacgtcatcaggggtgttagagtccttgtg
gatgctcgtgagaaacttcatattccatggggaaatcctgctaatcaaaagaacggtgac
aagatgatggcctttgatacccgtttagaagtggtgaaagggatggtgcaaacccagact
tttttacagtaccttccaacagtaagagctttgtgggcagatagtggtatccagcatgct
tatgacagacgcagagaatttcagctgggggaatctataaaatactttctggacaacttg
gataaacttggagacccagattaccttccctcccagcaagatattctgctagcacgaaga
cctacaaaagggatacatgagtacgattttgagattaaaaatgttcccttcaagatggtt
gatgtaggtggccagaggtcagaaagaaaacgttggtttgagtgctttgatagtgtcact
tcaatactattcctggtttcatcaagtgagtttgatcaggtacttatggaagaccggcta
acaaatcgccttacagaatctttgaacatttttgaaactatagtcaacaatcgggttttc
agcaatgtgtctattattctcttcctaaacaagacagacttgcttgaggaaaaagtgcaa
aaagtgagcatcaaagactatttcccagagtttgaaggggatccccacaacttaacagat
gtccaaaaattcctggtggattgttttcgtaccaaacgccgggaccagcaacagaagccc
ttataccaccatttcaccactgctattaatacagaaaatattcgtctggtattccgtgat
gtcaaagataccatccttcatgacaacctcaagcagctcatgctacagtga

DBGET integrated database retrieval system