KEGG   Python bivittatus (Burmese python): 103050846Help
Entry
103050846         CDS       T03091                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103050846
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pbi03041]
    103050846
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103050846
Spliceosome [BR:pbi03041]
 Complex C
  Other components
   Step II factors
    103050846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C
Motif
Other DBs
NCBI-GeneID: 103050846
NCBI-ProteinID: XP_007444138
Position
Unknown
AA seq 454 aa AA seqDB search
MALGLQEAPELQHNMKLQPPLEASAAPACPSSAAQSRRAPGSPSHASPIPLAVTLTTLHW
RIFVAFSAVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQ
RAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFM
DAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEML
TIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENF
IQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRT
LIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDP
TKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggctctggggctgcaagaagcccctgagctgcagcacaacatgaagctgcagccgcct
ctagaagcctcagctgccccagcctgccccagcagcgcagcacaaagccgcagggcccca
ggaagccccagccacgccagcccaatcccactcgcagtcaccctcaccaccctgcactgg
agaatatttgtggcattttctgcagtggtcattgccacaaatattgctgaaacttcactt
acaattgatggcatctattatgtagttgatcctggttttgtaaagcagaaagtatacaac
tccaagacagggattgaccagctggttgtgacaccaatttctcaggcccaagctaagcaa
cgagctggaagagctggaagaacaggccctggcaagtgctatcgactctacacagagcgg
gcctaccgtgatgagatgctgaccaccaatgtgcctgagattcagaggactaacctggcc
agcacggtattgtctctcaaggctatgggtatcaatgatttgctgtcttttgattttatg
gacgcccccccaatggaaactctgatcactgcaatggagcaactgtatactctgggagct
ttggatgatgaagggctgctcacgcgactggggcgcaggatggcagagttcccactggag
cctatgctttgcaagatgctcattatgtcagtgcacttaggttgcagcgaggaaatgctc
accattgtctcaatgctgtctgtgcaaaatgttttctatcgacctaaggacaagcaagct
cttgctgaccagaagaaagctaagttccaccaaactgaaggagaccacctcacacttttg
gctgtttacaactcctggaagaacaacaagttctccaatccctggtgctatgaaaatttc
atccaagcccgctcactacgtcgagcccaggatattcgtaagcagatgctgggaataatg
gataggcacaagttagatgtggtgtcttgtggaaaagcaacagtacgagtccagaaagcc
atatgcagtggtttcttccggaatgcagccaagaaggacccacaagagggctaccggacc
ttgattgatcagcaggtggtctatatccatccctcgagtgccctcttcaaccgccagcct
gaatgggtggtgtaccatgagcttgtgctcacaaccaaggagtatatgcgagaggttacc
accatagatccccgctggcttgtggagtttgccccagcctttttcaaggtttccgatccc
acaaagctgagcaagcagaagaagcagcagcgcctggagccactttacaatcgctatgag
gagcccaatgcctggaggatatcacgggcattcaggcgtcgatga

DBGET integrated database retrieval system