KEGG   Python bivittatus (Burmese python): 103051195
Entry
103051195         CDS       T03091                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pbi01009]
    103051195 (AKAP5)
Protein phosphatases and associated proteins [BR:pbi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     103051195 (AKAP5)
SSDB
Motif
Pfam: WSK PadR
Other DBs
NCBI-GeneID: 103051195
NCBI-ProteinID: XP_025027191
Position
Unknown
AA seq 505 aa
MQAQNMEHLGKGIQMESEQQLETPNTTDPIIAHESPAKKASVFCFKKRKKSCEKGAEKDE
NHESNLLSLRPTNQPSNMGHDKTEVSDPFWTSGGAWLAFKRLVTLRRRSKSTWKKQTQVY
SRVQLDVDIEDSGRSRFPKEHASSSFKIPCLRLSRSKKRTSHSEIIEQPDCKKKGSDATS
ILNSKSNEEPEIVAMEVPLNTRQSPSRDLQEKESDSGAMKNMENVALSSRENKFPVEVRP
DPNCYIDCGVQSEIIHSETALVTEEEKQIFQLHHGTLYGNLEELENQKFSFNVEISPLVP
QDLAESEQQPIEREGTKNAFTKEAKSQPFGTDVDVVVKSEDAAAKEGHSIEVMLHCSPSV
VEDEASDMPVCPDGEEKSEGNQLTMPGAGIVIMITEAEEYQDEEEESPPICETFAFPQAS
KQKGKKKTGRSHASSADCNYTKEDKTCSKVPSSFGTNSQERRTSEQYEVLLIETAASLVK
TAIQSSVEQLVNEMALEQNKQNSVL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgcaagcccaaaacatggagcatttaggaaaaggaattcagatggagagtgagcaacaa
ttggaaactccaaatacaactgatccaattattgcccatgagagcccggccaaaaaagct
tctgtcttttgctttaagaaaaggaaaaagtcctgtgagaagggagcagagaaggatgag
aaccatgaatccaatttacttagcttaaggcctactaaccagccttccaacatggggcat
gataaaacagaggtatcagatccattttggacttcaggaggggcctggttggctttcaaa
cgactggtgacattaagaagaagatccaaatccacttggaagaaacaaacacaggtttat
tctcgtgtacagctagatgtggacatagaagattctggcaggtcacgatttcctaaggag
catgccagttccagttttaaaattccctgcttacgactctcccgaagcaaaaaaaggacc
agccattctgaaataatagaacagccagattgcaagaaaaaaggaagtgatgccacaagc
atcctgaatagcaaaagtaatgaggagccagagattgtggctatggaggttccacttaat
acaagacaatctcccagcagagaccttcaggagaaagaaagtgacagtggagccatgaaa
aatatggaaaatgtggcattgtccagtagagagaacaagtttccagtggaagtaagacct
gatcccaattgttatattgactgtggagttcaatcagaaataatccattctgaaactgca
cttgtaactgaagaagagaagcaaatatttcagttacatcatggaaccctctatgggaac
cttgaagagttggaaaatcagaagttcagttttaatgttgagatcagtcctctcgttcct
caggacctggctgaaagcgaacaacaacccatagaaagagagggaaccaagaatgctttt
accaaagaggccaagtcccagccatttgggacagacgttgatgttgtggtcaaaagtgag
gatgctgctgctaaggaaggtcattccattgaagtgatgctgcattgcagcccatccgta
gtagaagatgaggcttcagacatgccagtctgtcctgatggggaagagaaaagtgaagga
aatcagctcaccatgcctggggccggcattgtaatcatgatcactgaagctgaagagtat
caggacgaagaagaagagtcacctcctatttgtgaaacttttgcatttccccaagccagc
aagcagaaagggaagaaaaaaactggcagaagccatgcttctagtgcagattgcaactac
acgaaggaagataaaacatgctccaaggtcccatcatcctttggcaccaacagccaggaa
cgccggacttcagagcaatatgaagtgctgttgatcgaaacagctgcctcacttgtgaag
acagccattcagtcatctgttgagcagcttgtcaatgaaatggctttggagcaaaataaa
caaaacagcgttctatga

DBGET integrated database retrieval system