KEGG   Python bivittatus (Burmese python): 103051318Help
Entry
103051318         CDS       T03091                                 

Gene name
CDK18
Definition
(RefSeq) cyclin-dependent kinase 18
  KO
K15596  cyclin-dependent kinase 18 [EC:2.7.11.22]
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbi01001]
    103051318 (CDK18)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     103051318 (CDK18)
Protein kinases [BR:pbi01001]
 Serine/threonine kinases: CMGC group
  CDK family
   103051318 (CDK18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo APH Seadorna_VP7 DNA_pol_A_exoN
Motif
Other DBs
NCBI-GeneID: 103051318
NCBI-ProteinID: XP_025032340
Position
Unknown
AA seq 471 aa AA seqDB search
MNKMKTFKRRFSLSVPRTETIEESLAEFTEQFNQLNNRKNEDMAQGHLHLGHLNRDIRMQ
PRSASPLEGRSPTPVRYRNGNQRRFSMEDVSKRLSLPMDIHLPPEFLQKLEMENPEISKP
LSRMSRRASLSDIGFGKMETYVKLEKLGEGTYATVFKGRSKLTKNLVALKEIRLEHEEGA
PCTAIREVSLLKNLKHANIVTLHDIIHTKCSLTLVFEYLDSDLKQYLDNCGNLMSTYNVK
IFMFQLLRGLSYCHQHKILHRDLKPQNLLINGKGELKLADFGLARAKSVPTKTYSNEVVT
LWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMVTGRPMFPGSTVKEELNLIFRMLGTPTEE
SWPGITSNEEFKAYNFTQYRAQPLINHAPRLDTEGIDLLTSLLLYEAKQRISAESALRHP
YFMILDERVHLLPETASIFSLKEIQLQKDPGCRGSSFQHVARGKNRRQSIF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatgaaaacgttcaagcgccgcttttccctttcagttccccggacagagact
atcgaggaatccctggcagagtttacagagcagttcaaccagctcaacaacaggaagaat
gaagatatggcacaaggacatttacatctgggtcacctgaatagggacatccgaatgcag
cccaggtctgcctcacctttggaaggtcggtccccaactcctgtgcgttaccgaaatggc
aaccagcgccgcttttctatggaggatgtgagcaagcgtctctctctgcctatggatatt
cacctgcccccagaattcctccagaagctagaaatggaaaatccagagatttctaagcct
ctgagcaggatgtcacgacgggcatctctttcagacattgggtttgggaagatggaaacc
tatgttaaactggaaaagctgggggagggcacttatgctactgtttttaaaggacgcagc
aaactcaccaagaatcttgttgcgctgaaggagatcaggttggaacatgaagaaggggct
ccctgcacagctatacgggaagtttccttactgaagaatctaaagcatgccaacattgtg
actctgcatgatatcattcacacaaaatgctccctcacacttgtctttgaatatctggac
agtgacttgaaacagtacctggataactgtgggaatctgatgagcacgtacaacgtgaag
attttcatgttccagctgcttcgtggtttatcctactgccaccagcataagatcctacac
agagatctcaagccacagaatctgctcattaatgggaaaggagagctgaaacttgctgac
tttggtctagccagagccaagtctgtcccaacaaaaacatattccaatgaagtggtcaca
ttatggtaccgacctcctgatgtcctactaggatctacagaatattccactcccattgac
atgtggggtgtgggttgcatacactatgaaatggtcacaggacgtccaatgttcccagga
tccactgtgaaagaagaacttaatttaatattcagaatgttgggaactcctacagaagaa
tcttggcctggcatcacatccaatgaggagttcaaagcttacaatttcacacagtatcga
gcccaacccttgataaatcatgcacccaggctagacacagaaggaattgaccttttgaca
agtctcctcctgtatgaagccaaacaacgtatttctgctgaatcagctctacgacatccc
tactttatgatcctagatgaacgagtacacctccttcctgagactgcctccatcttttct
ttgaaggaaattcaacttcaaaaggaccctggctgcagaggctcaagtttccagcacgtt
gctcgtggaaagaataggaggcaaagcatattttaa

DBGET integrated database retrieval system